Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SBW2

Protein Details
Accession A0A2N5SBW2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-189DEPTPSRTWTRKRGARRSKHLPESTQKHHydrophilic
NLS Segment(s)
PositionSequence
172-180RKRGARRSK
Subcellular Location(s) nucl 13, cyto 9, mito 3
Family & Domain DBs
Amino Acid Sequences MFRDEADWKQLRAEMIELWGEFEKPLLFYTTQDLLKLKEEVVSQGGITNYQEFKDYLAEFSEILDNLVEAARHAGFALKFANRLDQRAGRRPANMMGWLSPGQKSKAISRRYHTVEKSDREEWETYQIQAKRPADVVDEAIQRRWRGYSNSSQLTGYSRDADEPTPSRTWTRKRGARRSKHLPESTQKHPAQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.2
4 0.17
5 0.17
6 0.17
7 0.16
8 0.14
9 0.14
10 0.12
11 0.1
12 0.11
13 0.12
14 0.12
15 0.12
16 0.17
17 0.22
18 0.22
19 0.23
20 0.23
21 0.21
22 0.24
23 0.24
24 0.19
25 0.17
26 0.17
27 0.17
28 0.18
29 0.16
30 0.13
31 0.14
32 0.14
33 0.12
34 0.12
35 0.13
36 0.12
37 0.12
38 0.14
39 0.11
40 0.12
41 0.15
42 0.15
43 0.13
44 0.13
45 0.14
46 0.12
47 0.13
48 0.13
49 0.1
50 0.09
51 0.08
52 0.07
53 0.06
54 0.07
55 0.06
56 0.04
57 0.06
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.08
64 0.11
65 0.1
66 0.11
67 0.11
68 0.19
69 0.17
70 0.19
71 0.22
72 0.25
73 0.3
74 0.37
75 0.42
76 0.36
77 0.36
78 0.36
79 0.35
80 0.3
81 0.27
82 0.19
83 0.15
84 0.15
85 0.16
86 0.15
87 0.15
88 0.15
89 0.14
90 0.16
91 0.17
92 0.22
93 0.29
94 0.35
95 0.37
96 0.39
97 0.46
98 0.49
99 0.55
100 0.49
101 0.49
102 0.5
103 0.5
104 0.51
105 0.46
106 0.42
107 0.38
108 0.38
109 0.3
110 0.3
111 0.26
112 0.22
113 0.26
114 0.27
115 0.27
116 0.34
117 0.33
118 0.28
119 0.28
120 0.28
121 0.24
122 0.23
123 0.23
124 0.19
125 0.23
126 0.22
127 0.25
128 0.28
129 0.25
130 0.25
131 0.24
132 0.23
133 0.23
134 0.28
135 0.35
136 0.4
137 0.43
138 0.44
139 0.42
140 0.4
141 0.38
142 0.35
143 0.27
144 0.21
145 0.18
146 0.19
147 0.2
148 0.21
149 0.24
150 0.23
151 0.27
152 0.26
153 0.27
154 0.31
155 0.37
156 0.45
157 0.49
158 0.56
159 0.6
160 0.69
161 0.78
162 0.83
163 0.86
164 0.88
165 0.89
166 0.89
167 0.91
168 0.87
169 0.84
170 0.83
171 0.79
172 0.77
173 0.76