Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W705

Protein Details
Accession A0A2N5W705    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-45NAEPEEPESRRRRHRRPRAPPRPAVPPLBasic
142-168MPQAGPSRQGRRPQRRDPYDERGRNRAHydrophilic
NLS Segment(s)
PositionSequence
26-40SRRRRHRRPRAPPRP
152-156RRPQR
Subcellular Location(s) nucl 18, cyto 3, extr 3, mito 2
Family & Domain DBs
Amino Acid Sequences MDPQRLLAMFMPIINARNAEPEEPESRRRRHRRPRAPPRPAVPPLDPARNPILLDGRVQLPKPLFLTPHAKESAFADLRDQVLSLPTRHPSGARHPRVYTLIYQNDSRPLAHRGSPPRSARHALRVVNRGAPPPPQLIPSLMPQAGPSRQGRRPQRRDPYDERGRNRARGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.17
5 0.19
6 0.17
7 0.19
8 0.22
9 0.27
10 0.3
11 0.39
12 0.42
13 0.48
14 0.58
15 0.65
16 0.72
17 0.77
18 0.85
19 0.87
20 0.91
21 0.95
22 0.95
23 0.95
24 0.92
25 0.85
26 0.83
27 0.76
28 0.7
29 0.61
30 0.58
31 0.52
32 0.52
33 0.47
34 0.41
35 0.4
36 0.35
37 0.33
38 0.27
39 0.26
40 0.19
41 0.2
42 0.18
43 0.18
44 0.19
45 0.19
46 0.2
47 0.16
48 0.18
49 0.18
50 0.18
51 0.15
52 0.17
53 0.25
54 0.23
55 0.28
56 0.27
57 0.25
58 0.24
59 0.25
60 0.29
61 0.22
62 0.21
63 0.17
64 0.17
65 0.17
66 0.17
67 0.16
68 0.08
69 0.09
70 0.1
71 0.1
72 0.1
73 0.11
74 0.12
75 0.12
76 0.13
77 0.13
78 0.23
79 0.33
80 0.37
81 0.39
82 0.39
83 0.41
84 0.42
85 0.41
86 0.34
87 0.3
88 0.29
89 0.27
90 0.28
91 0.26
92 0.28
93 0.28
94 0.24
95 0.2
96 0.19
97 0.2
98 0.22
99 0.28
100 0.32
101 0.37
102 0.44
103 0.46
104 0.48
105 0.51
106 0.52
107 0.48
108 0.49
109 0.5
110 0.47
111 0.5
112 0.5
113 0.47
114 0.48
115 0.46
116 0.4
117 0.35
118 0.33
119 0.29
120 0.27
121 0.26
122 0.22
123 0.22
124 0.22
125 0.23
126 0.23
127 0.26
128 0.22
129 0.21
130 0.21
131 0.24
132 0.23
133 0.27
134 0.29
135 0.31
136 0.37
137 0.47
138 0.57
139 0.63
140 0.71
141 0.77
142 0.82
143 0.84
144 0.87
145 0.86
146 0.85
147 0.85
148 0.84
149 0.8
150 0.8
151 0.77