Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5UUK2

Protein Details
Accession A0A2N5UUK2    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-94AIWARSCDPAKQKRRPKGHMVNGPLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 2, cyto 1, plas 1, extr 1
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MQTPTCRTPKNGVRTAGLACSPSGQACWPCTPVRRACRPCTPSGQACTAGTPVRPGSRTQRDGSDVIIAIWARSCDPAKQKRRPKGHMVNGPLAASPNRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.44
4 0.36
5 0.27
6 0.2
7 0.18
8 0.16
9 0.13
10 0.12
11 0.12
12 0.14
13 0.16
14 0.18
15 0.19
16 0.22
17 0.26
18 0.31
19 0.37
20 0.42
21 0.5
22 0.54
23 0.57
24 0.64
25 0.65
26 0.62
27 0.61
28 0.58
29 0.51
30 0.48
31 0.45
32 0.36
33 0.32
34 0.29
35 0.23
36 0.18
37 0.14
38 0.13
39 0.11
40 0.12
41 0.13
42 0.14
43 0.22
44 0.3
45 0.34
46 0.33
47 0.35
48 0.37
49 0.36
50 0.35
51 0.28
52 0.2
53 0.16
54 0.16
55 0.13
56 0.09
57 0.1
58 0.09
59 0.07
60 0.1
61 0.11
62 0.14
63 0.24
64 0.35
65 0.44
66 0.54
67 0.64
68 0.71
69 0.8
70 0.83
71 0.84
72 0.85
73 0.85
74 0.84
75 0.81
76 0.77
77 0.69
78 0.62
79 0.52
80 0.44