Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SXT3

Protein Details
Accession G0SXT3   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-58APPSAPPTKRKGARRRTPVTEHydrophilic
NLS Segment(s)
PositionSequence
45-53TKRKGARRR
Subcellular Location(s) cyto 11, cyto_nucl 10.333, cyto_mito 9.333, nucl 8.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MGWMRRGVYAAALPAEPLDIKDAAKPSVEHIERVDIPAPPSAPPTKRKGARRRTPVTEEELAIAAGGREPVDPDDLPFIPPESISKHDNLKDGLWIVVEDRVYDCTNFLDLHPGGPEVFHQFAGKQCTWQFWKWHSRKHLEPWEESLLIGYTYPVPPNPYPEPKRWIRTGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.1
5 0.11
6 0.1
7 0.11
8 0.14
9 0.17
10 0.17
11 0.18
12 0.18
13 0.19
14 0.28
15 0.28
16 0.26
17 0.25
18 0.3
19 0.29
20 0.31
21 0.3
22 0.21
23 0.21
24 0.22
25 0.22
26 0.16
27 0.2
28 0.23
29 0.26
30 0.3
31 0.35
32 0.42
33 0.49
34 0.58
35 0.65
36 0.7
37 0.75
38 0.8
39 0.81
40 0.79
41 0.78
42 0.71
43 0.67
44 0.58
45 0.48
46 0.39
47 0.31
48 0.24
49 0.17
50 0.14
51 0.07
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.08
59 0.08
60 0.08
61 0.11
62 0.11
63 0.12
64 0.11
65 0.11
66 0.09
67 0.09
68 0.1
69 0.09
70 0.12
71 0.13
72 0.14
73 0.17
74 0.19
75 0.21
76 0.21
77 0.19
78 0.17
79 0.16
80 0.14
81 0.1
82 0.09
83 0.07
84 0.08
85 0.07
86 0.07
87 0.07
88 0.09
89 0.1
90 0.1
91 0.1
92 0.08
93 0.1
94 0.1
95 0.09
96 0.13
97 0.12
98 0.13
99 0.13
100 0.13
101 0.11
102 0.11
103 0.12
104 0.1
105 0.11
106 0.11
107 0.11
108 0.12
109 0.15
110 0.22
111 0.21
112 0.21
113 0.21
114 0.27
115 0.31
116 0.34
117 0.37
118 0.38
119 0.49
120 0.51
121 0.59
122 0.62
123 0.64
124 0.67
125 0.71
126 0.74
127 0.68
128 0.65
129 0.63
130 0.59
131 0.52
132 0.45
133 0.36
134 0.26
135 0.21
136 0.18
137 0.13
138 0.09
139 0.11
140 0.12
141 0.13
142 0.18
143 0.19
144 0.26
145 0.33
146 0.41
147 0.46
148 0.51
149 0.58
150 0.61
151 0.66
152 0.65