Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5T5Y6

Protein Details
Accession A0A2N5T5Y6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-97GVESKKKKKNILCHPNLQNSLHydrophilic
NLS Segment(s)
PositionSequence
81-85KKKKK
Subcellular Location(s) nucl 6, cyto 5, mito 3, plas 3, pero 3, extr 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFPSFYRAQEHAGDAGVQPNTTSQSGTGRKTGPMNPSHLNKAVRKDPAVFPLAIIIGGVICAAGYFAFNKAPKEGGGVESKKKKKNILCHPNLQNSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.16
4 0.14
5 0.12
6 0.12
7 0.14
8 0.14
9 0.13
10 0.1
11 0.18
12 0.23
13 0.25
14 0.28
15 0.26
16 0.28
17 0.31
18 0.35
19 0.33
20 0.32
21 0.35
22 0.36
23 0.38
24 0.39
25 0.4
26 0.4
27 0.37
28 0.39
29 0.39
30 0.37
31 0.35
32 0.35
33 0.31
34 0.3
35 0.29
36 0.24
37 0.18
38 0.16
39 0.15
40 0.11
41 0.09
42 0.05
43 0.03
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.03
53 0.05
54 0.09
55 0.11
56 0.12
57 0.13
58 0.14
59 0.14
60 0.17
61 0.17
62 0.16
63 0.23
64 0.26
65 0.33
66 0.42
67 0.5
68 0.54
69 0.58
70 0.64
71 0.64
72 0.71
73 0.74
74 0.75
75 0.76
76 0.79
77 0.82
78 0.83