Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5UFH3

Protein Details
Accession A0A2N5UFH3   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
85-112YSTNPPPRPHQTPRPHIKPKKGLPSPFWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 7, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MARPPPEVLVAISNKEMGGGNHYCITPLAATLLLQLRGSRKPLESRGLREPAQASSAGTDLGAGTEARHQPPGSASERPATPDDYSTNPPPRPHQTPRPHIKPKKGLPSPFWAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.12
5 0.15
6 0.15
7 0.16
8 0.18
9 0.18
10 0.17
11 0.17
12 0.17
13 0.11
14 0.1
15 0.09
16 0.07
17 0.07
18 0.09
19 0.11
20 0.1
21 0.1
22 0.12
23 0.14
24 0.16
25 0.18
26 0.18
27 0.19
28 0.23
29 0.27
30 0.35
31 0.35
32 0.38
33 0.43
34 0.45
35 0.43
36 0.39
37 0.36
38 0.29
39 0.26
40 0.21
41 0.14
42 0.1
43 0.1
44 0.08
45 0.06
46 0.06
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.08
53 0.1
54 0.11
55 0.13
56 0.13
57 0.13
58 0.15
59 0.19
60 0.18
61 0.19
62 0.2
63 0.21
64 0.22
65 0.24
66 0.24
67 0.22
68 0.2
69 0.2
70 0.21
71 0.22
72 0.27
73 0.31
74 0.37
75 0.38
76 0.39
77 0.44
78 0.49
79 0.53
80 0.57
81 0.6
82 0.63
83 0.71
84 0.79
85 0.82
86 0.86
87 0.86
88 0.88
89 0.88
90 0.87
91 0.88
92 0.86
93 0.82
94 0.77