Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5UTH7

Protein Details
Accession A0A2N5UTH7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-110DVDDLKKWVKQQKKKSSKKNNPILAAKKKEHydrophilic
NLS Segment(s)
PositionSequence
88-109WVKQQKKKSSKKNNPILAAKKK
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 9.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005011  SNU66/SART1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03343  SART-1  
Amino Acid Sequences MLLGYPPTSGVSWVLAQRSLDNELDPDQLAEQNYTKHCQDEQDTVQAKKVAERVLKAKENRERLAKLSGRGLGELAPDQEDVDDLKKWVKQQKKKSSKKNNPILAAKKKEAELNEDEVEYGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.18
5 0.2
6 0.21
7 0.19
8 0.17
9 0.17
10 0.17
11 0.18
12 0.16
13 0.14
14 0.12
15 0.13
16 0.13
17 0.13
18 0.13
19 0.15
20 0.17
21 0.2
22 0.2
23 0.2
24 0.2
25 0.21
26 0.24
27 0.26
28 0.26
29 0.32
30 0.35
31 0.33
32 0.35
33 0.34
34 0.31
35 0.27
36 0.27
37 0.23
38 0.22
39 0.24
40 0.26
41 0.29
42 0.35
43 0.35
44 0.4
45 0.42
46 0.46
47 0.46
48 0.46
49 0.41
50 0.38
51 0.43
52 0.38
53 0.32
54 0.3
55 0.3
56 0.25
57 0.24
58 0.22
59 0.14
60 0.13
61 0.12
62 0.1
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.1
73 0.12
74 0.18
75 0.26
76 0.35
77 0.43
78 0.53
79 0.64
80 0.73
81 0.82
82 0.88
83 0.91
84 0.93
85 0.94
86 0.93
87 0.9
88 0.87
89 0.86
90 0.84
91 0.83
92 0.79
93 0.72
94 0.65
95 0.59
96 0.55
97 0.48
98 0.45
99 0.39
100 0.38
101 0.36
102 0.32