Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5T2S1

Protein Details
Accession A0A2N5T2S1    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGVQKKKLTRQERRAQPMANHydrophilic
76-101EISDKLYNKTHKKNERKENRLAAKKIHydrophilic
NLS Segment(s)
PositionSequence
48-74AEHKERNKTIKKGKALSNKQKMKIQRG
83-99NKTHKKNERKENRLAAK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGVQKKKLTRQERRAQPMANVVPHEPLITEDEPRTLTATTSHKKVNHAEHKERNKTIKKGKALSNKQKMKIQRGVEISDKLYNKTHKKNERKENRLAAKKIYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.69
4 0.67
5 0.61
6 0.53
7 0.45
8 0.37
9 0.32
10 0.3
11 0.27
12 0.17
13 0.14
14 0.16
15 0.15
16 0.16
17 0.14
18 0.15
19 0.16
20 0.16
21 0.16
22 0.11
23 0.11
24 0.13
25 0.2
26 0.22
27 0.24
28 0.28
29 0.28
30 0.32
31 0.36
32 0.42
33 0.44
34 0.5
35 0.56
36 0.6
37 0.67
38 0.7
39 0.68
40 0.67
41 0.64
42 0.63
43 0.64
44 0.62
45 0.59
46 0.59
47 0.64
48 0.66
49 0.7
50 0.73
51 0.75
52 0.74
53 0.72
54 0.72
55 0.7
56 0.68
57 0.65
58 0.57
59 0.53
60 0.5
61 0.49
62 0.47
63 0.44
64 0.38
65 0.36
66 0.34
67 0.3
68 0.32
69 0.37
70 0.42
71 0.49
72 0.57
73 0.62
74 0.72
75 0.8
76 0.85
77 0.88
78 0.87
79 0.87
80 0.87
81 0.87
82 0.86
83 0.8