Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U9B6

Protein Details
Accession A0A2N5U9B6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-99DEKQLQPSKKTKKAPGTSKKSSEHydrophilic
124-151FDGKSTKKSIKTKKAPTKKKKNDSEIELHydrophilic
NLS Segment(s)
PositionSequence
129-144TKKSIKTKKAPTKKKK
Subcellular Location(s) nucl 15, cyto_nucl 11.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MPCGCTSATSLPPSSLPKNTSTLHSLISIPPPKLPTTKSSPHHNIKMPSTKQINSSPTPTQEKKTKKTNAWSIDNDDEKQLQPSKKTKKAPGTSKKSSELESGNNLDSDTSKNDIKEAKETIDFDGKSTKKSIKTKKAPTKKKKNDSEIELDGGEHNNPPTTCHPNFNEDKDVQICCSWLEVTDNPLNSTNQTSTTFWARVCEHYLIRIPMYQHPISSIKTCWQVLQRYINKFHGCLKQVKQANQSGLTQKDQLNRALELCAALEGRLFNNLCCYNILNEAEKWNSYFSDLELKRSMLPSSSIELSSKISHSEAPSNITVVQSTKPGETSRPIGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.35
4 0.34
5 0.39
6 0.39
7 0.4
8 0.39
9 0.36
10 0.31
11 0.3
12 0.29
13 0.26
14 0.34
15 0.34
16 0.3
17 0.32
18 0.33
19 0.34
20 0.37
21 0.37
22 0.34
23 0.38
24 0.46
25 0.48
26 0.56
27 0.62
28 0.67
29 0.72
30 0.72
31 0.7
32 0.69
33 0.74
34 0.66
35 0.65
36 0.62
37 0.57
38 0.55
39 0.56
40 0.54
41 0.47
42 0.5
43 0.46
44 0.46
45 0.53
46 0.51
47 0.5
48 0.53
49 0.59
50 0.61
51 0.66
52 0.69
53 0.68
54 0.75
55 0.78
56 0.77
57 0.75
58 0.72
59 0.68
60 0.66
61 0.61
62 0.52
63 0.44
64 0.38
65 0.31
66 0.32
67 0.32
68 0.28
69 0.32
70 0.41
71 0.49
72 0.56
73 0.63
74 0.67
75 0.71
76 0.77
77 0.81
78 0.82
79 0.82
80 0.81
81 0.78
82 0.76
83 0.67
84 0.6
85 0.53
86 0.46
87 0.39
88 0.36
89 0.33
90 0.27
91 0.25
92 0.23
93 0.19
94 0.16
95 0.15
96 0.13
97 0.13
98 0.14
99 0.14
100 0.17
101 0.2
102 0.21
103 0.23
104 0.23
105 0.22
106 0.23
107 0.24
108 0.24
109 0.27
110 0.25
111 0.21
112 0.28
113 0.26
114 0.25
115 0.27
116 0.3
117 0.31
118 0.41
119 0.5
120 0.53
121 0.62
122 0.72
123 0.79
124 0.85
125 0.88
126 0.9
127 0.92
128 0.91
129 0.92
130 0.9
131 0.89
132 0.84
133 0.78
134 0.73
135 0.63
136 0.54
137 0.44
138 0.35
139 0.26
140 0.2
141 0.15
142 0.09
143 0.08
144 0.08
145 0.08
146 0.11
147 0.14
148 0.21
149 0.21
150 0.25
151 0.27
152 0.31
153 0.34
154 0.34
155 0.35
156 0.28
157 0.28
158 0.26
159 0.24
160 0.19
161 0.16
162 0.14
163 0.09
164 0.1
165 0.08
166 0.06
167 0.08
168 0.08
169 0.12
170 0.14
171 0.15
172 0.15
173 0.17
174 0.17
175 0.15
176 0.17
177 0.13
178 0.13
179 0.15
180 0.15
181 0.15
182 0.18
183 0.19
184 0.17
185 0.2
186 0.19
187 0.18
188 0.21
189 0.22
190 0.19
191 0.2
192 0.23
193 0.21
194 0.2
195 0.2
196 0.19
197 0.21
198 0.27
199 0.24
200 0.21
201 0.24
202 0.25
203 0.25
204 0.25
205 0.22
206 0.19
207 0.23
208 0.24
209 0.23
210 0.27
211 0.29
212 0.32
213 0.41
214 0.44
215 0.45
216 0.5
217 0.53
218 0.49
219 0.46
220 0.48
221 0.45
222 0.42
223 0.44
224 0.43
225 0.45
226 0.5
227 0.54
228 0.53
229 0.51
230 0.51
231 0.47
232 0.46
233 0.43
234 0.4
235 0.37
236 0.34
237 0.33
238 0.35
239 0.35
240 0.36
241 0.33
242 0.31
243 0.29
244 0.26
245 0.23
246 0.17
247 0.15
248 0.11
249 0.09
250 0.08
251 0.08
252 0.08
253 0.08
254 0.13
255 0.13
256 0.12
257 0.19
258 0.2
259 0.2
260 0.21
261 0.22
262 0.18
263 0.23
264 0.26
265 0.22
266 0.22
267 0.25
268 0.26
269 0.25
270 0.24
271 0.21
272 0.19
273 0.18
274 0.17
275 0.15
276 0.23
277 0.23
278 0.27
279 0.28
280 0.29
281 0.29
282 0.3
283 0.29
284 0.21
285 0.23
286 0.21
287 0.23
288 0.24
289 0.23
290 0.22
291 0.22
292 0.24
293 0.23
294 0.21
295 0.19
296 0.18
297 0.2
298 0.23
299 0.29
300 0.27
301 0.3
302 0.3
303 0.29
304 0.29
305 0.26
306 0.23
307 0.19
308 0.19
309 0.18
310 0.19
311 0.19
312 0.21
313 0.23
314 0.26
315 0.29
316 0.32