Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5TYK5

Protein Details
Accession A0A2N5TYK5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-74SQTNAQTQPKKKSRRKTKCTIVDNGEHydrophilic
NLS Segment(s)
PositionSequence
58-64KKKSRRK
Subcellular Location(s) nucl 15.5, cyto_nucl 8.5, mito 5, extr 4
Family & Domain DBs
Amino Acid Sequences MVLTTPVLFQATLTTKTSQEILQSPAIRTPITSNCTTTAAQLGAQEQPSQTNAQTQPKKKSRRKTKCTIVDNGELPEPTSTNPPDVTSASAPTTNETVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.25
5 0.2
6 0.2
7 0.19
8 0.2
9 0.24
10 0.26
11 0.25
12 0.26
13 0.27
14 0.23
15 0.21
16 0.21
17 0.21
18 0.23
19 0.24
20 0.23
21 0.23
22 0.26
23 0.26
24 0.22
25 0.18
26 0.14
27 0.13
28 0.12
29 0.12
30 0.1
31 0.11
32 0.11
33 0.09
34 0.09
35 0.1
36 0.1
37 0.09
38 0.13
39 0.16
40 0.24
41 0.31
42 0.36
43 0.45
44 0.53
45 0.64
46 0.67
47 0.75
48 0.77
49 0.81
50 0.85
51 0.85
52 0.87
53 0.86
54 0.84
55 0.81
56 0.75
57 0.69
58 0.62
59 0.53
60 0.44
61 0.34
62 0.28
63 0.22
64 0.17
65 0.13
66 0.16
67 0.16
68 0.17
69 0.18
70 0.18
71 0.2
72 0.21
73 0.24
74 0.2
75 0.21
76 0.21
77 0.23
78 0.22
79 0.22