Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TI11

Protein Details
Accession A0A2N5TI11    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-72GDKADKKKKNHTWTDNQRVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences MSHLPSSIDPNLLPSLEMTPAPAQKKLDSELPKTNKNQIKPSMKEEDNNNEDGDKADKKKKNHTWTDNQRVALVTFILDQIALGKGTNNGNLKAEAWNPVVKEMDTHFEIQFDQEQVKNQKGAIQKLYINMKFLIGKVIGINTPLSAPKHFLKAKYLGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.14
5 0.14
6 0.16
7 0.22
8 0.24
9 0.26
10 0.26
11 0.27
12 0.3
13 0.3
14 0.35
15 0.35
16 0.38
17 0.45
18 0.49
19 0.53
20 0.53
21 0.6
22 0.57
23 0.57
24 0.59
25 0.59
26 0.63
27 0.6
28 0.63
29 0.62
30 0.58
31 0.57
32 0.54
33 0.53
34 0.46
35 0.43
36 0.37
37 0.29
38 0.27
39 0.24
40 0.23
41 0.18
42 0.2
43 0.28
44 0.33
45 0.37
46 0.47
47 0.56
48 0.62
49 0.67
50 0.7
51 0.72
52 0.78
53 0.84
54 0.78
55 0.68
56 0.59
57 0.5
58 0.42
59 0.31
60 0.2
61 0.1
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.06
73 0.07
74 0.12
75 0.12
76 0.13
77 0.14
78 0.14
79 0.15
80 0.15
81 0.15
82 0.14
83 0.15
84 0.16
85 0.15
86 0.16
87 0.16
88 0.14
89 0.15
90 0.12
91 0.15
92 0.14
93 0.16
94 0.15
95 0.15
96 0.15
97 0.15
98 0.16
99 0.13
100 0.13
101 0.12
102 0.18
103 0.22
104 0.24
105 0.24
106 0.22
107 0.26
108 0.3
109 0.34
110 0.31
111 0.31
112 0.3
113 0.35
114 0.43
115 0.39
116 0.36
117 0.31
118 0.3
119 0.28
120 0.26
121 0.24
122 0.16
123 0.16
124 0.14
125 0.16
126 0.14
127 0.14
128 0.14
129 0.1
130 0.12
131 0.15
132 0.16
133 0.16
134 0.2
135 0.22
136 0.31
137 0.34
138 0.35
139 0.39