Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5T7U6

Protein Details
Accession A0A2N5T7U6    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-31EKELAKKSRRRSLGRRAPTSRBasic
NLS Segment(s)
PositionSequence
15-29AKKSRRRSLGRRAPT
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MGQSDSSLGAEKELAKKSRRRSLGRRAPTSRRIDAPVSESLENPLLPCRSQLGTGSQYLPAWKGQLGKLISVHDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.41
4 0.49
5 0.57
6 0.62
7 0.65
8 0.68
9 0.74
10 0.78
11 0.81
12 0.81
13 0.79
14 0.78
15 0.78
16 0.76
17 0.67
18 0.59
19 0.53
20 0.46
21 0.4
22 0.36
23 0.3
24 0.26
25 0.23
26 0.2
27 0.18
28 0.17
29 0.16
30 0.13
31 0.13
32 0.11
33 0.1
34 0.11
35 0.12
36 0.12
37 0.14
38 0.15
39 0.17
40 0.19
41 0.21
42 0.21
43 0.2
44 0.2
45 0.19
46 0.19
47 0.15
48 0.14
49 0.14
50 0.16
51 0.16
52 0.23
53 0.23
54 0.25
55 0.26