Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U9R0

Protein Details
Accession A0A2N5U9R0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-51DLLKAARRRRHHDPLPNRIQDSHydrophilic
NLS Segment(s)
PositionSequence
36-38RRR
143-161KGSMAGSRRAAGKAAKAAK
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MRGNRCGSWKNARVTAPRVARPSARAVPGDLLKAARRRRHHDPLPNRIQDSSRLHQMDNAGSADLQWFLVRGWNSRVVKRGGFMFSSEPGNLKNKHSPRYSGLIHPKPMSVTPAPSGGVLITTRKDSANPRQLKAARNTVRVKGSMAGSRRAAGKAAKAAKNYRSDLARAAILRAARIAQSNVRSNKPKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.58
4 0.57
5 0.55
6 0.52
7 0.5
8 0.47
9 0.5
10 0.47
11 0.43
12 0.38
13 0.35
14 0.37
15 0.36
16 0.34
17 0.27
18 0.23
19 0.24
20 0.31
21 0.37
22 0.4
23 0.45
24 0.51
25 0.59
26 0.68
27 0.72
28 0.75
29 0.77
30 0.8
31 0.83
32 0.8
33 0.72
34 0.64
35 0.56
36 0.53
37 0.51
38 0.44
39 0.42
40 0.38
41 0.37
42 0.37
43 0.38
44 0.31
45 0.26
46 0.22
47 0.14
48 0.12
49 0.12
50 0.11
51 0.09
52 0.08
53 0.05
54 0.05
55 0.05
56 0.09
57 0.09
58 0.11
59 0.13
60 0.21
61 0.24
62 0.25
63 0.29
64 0.28
65 0.28
66 0.27
67 0.27
68 0.21
69 0.19
70 0.18
71 0.16
72 0.15
73 0.16
74 0.15
75 0.12
76 0.12
77 0.17
78 0.17
79 0.19
80 0.26
81 0.28
82 0.34
83 0.35
84 0.37
85 0.35
86 0.39
87 0.38
88 0.37
89 0.43
90 0.41
91 0.42
92 0.39
93 0.36
94 0.32
95 0.3
96 0.27
97 0.18
98 0.16
99 0.15
100 0.15
101 0.15
102 0.14
103 0.14
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.09
110 0.1
111 0.1
112 0.13
113 0.18
114 0.27
115 0.36
116 0.4
117 0.4
118 0.48
119 0.51
120 0.55
121 0.55
122 0.55
123 0.51
124 0.54
125 0.57
126 0.53
127 0.53
128 0.47
129 0.43
130 0.36
131 0.33
132 0.31
133 0.29
134 0.29
135 0.27
136 0.28
137 0.29
138 0.26
139 0.26
140 0.22
141 0.23
142 0.27
143 0.34
144 0.36
145 0.39
146 0.45
147 0.49
148 0.54
149 0.53
150 0.49
151 0.44
152 0.42
153 0.4
154 0.36
155 0.34
156 0.28
157 0.26
158 0.24
159 0.21
160 0.2
161 0.18
162 0.17
163 0.14
164 0.16
165 0.18
166 0.22
167 0.28
168 0.36
169 0.41
170 0.48
171 0.54