Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W671

Protein Details
Accession A0A2N5W671    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-103AERAQREPPHKKPRKSCPSPKVRRSQRVLDQHydrophilic
NLS Segment(s)
PositionSequence
77-93QREPPHKKPRKSCPSPK
Subcellular Location(s) mito 14, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MNILRLHAAFLTTNLPITTAVQPDQMLSPPQVINRSTSAPLPMIKPLTQPAPAATPLKPSVTAPEAPGPAPVAERAQREPPHKKPRKSCPSPKVRRSQRVLDQRHHGLGSLMLPAEYLGVEKLAIEGVSKTKHSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.14
5 0.16
6 0.16
7 0.16
8 0.17
9 0.17
10 0.17
11 0.18
12 0.17
13 0.15
14 0.14
15 0.16
16 0.15
17 0.18
18 0.21
19 0.2
20 0.21
21 0.21
22 0.24
23 0.22
24 0.21
25 0.21
26 0.19
27 0.2
28 0.18
29 0.19
30 0.19
31 0.18
32 0.19
33 0.19
34 0.2
35 0.2
36 0.19
37 0.16
38 0.16
39 0.18
40 0.19
41 0.17
42 0.18
43 0.18
44 0.18
45 0.17
46 0.15
47 0.16
48 0.17
49 0.17
50 0.15
51 0.17
52 0.17
53 0.16
54 0.16
55 0.13
56 0.11
57 0.1
58 0.09
59 0.08
60 0.11
61 0.13
62 0.15
63 0.21
64 0.25
65 0.32
66 0.4
67 0.48
68 0.57
69 0.64
70 0.7
71 0.72
72 0.79
73 0.83
74 0.85
75 0.85
76 0.84
77 0.87
78 0.89
79 0.89
80 0.88
81 0.88
82 0.87
83 0.82
84 0.81
85 0.79
86 0.79
87 0.77
88 0.72
89 0.7
90 0.64
91 0.61
92 0.52
93 0.42
94 0.32
95 0.27
96 0.22
97 0.16
98 0.12
99 0.09
100 0.09
101 0.08
102 0.08
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.08
114 0.12
115 0.15
116 0.18