Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5S5M7

Protein Details
Accession A0A2N5S5M7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-80AARPHQTPRPHIKPNRGGPFVHydrophilic
NLS Segment(s)
PositionSequence
22-39SARPKGMRTPIRTPNKHG
45-78APLERRAGAARHSQHAARPHQTPRPHIKPNRGGP
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MGLDSGTPEGHAHARRACARPSARPKGMRTPIRTPNKHGVQPLHAPLERRAGAARHSQHAARPHQTPRPHIKPNRGGPFVGPKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.4
4 0.4
5 0.43
6 0.44
7 0.5
8 0.57
9 0.6
10 0.61
11 0.64
12 0.66
13 0.67
14 0.73
15 0.7
16 0.67
17 0.65
18 0.68
19 0.72
20 0.69
21 0.65
22 0.65
23 0.63
24 0.59
25 0.55
26 0.47
27 0.41
28 0.42
29 0.38
30 0.33
31 0.28
32 0.27
33 0.25
34 0.29
35 0.25
36 0.22
37 0.21
38 0.18
39 0.2
40 0.26
41 0.26
42 0.23
43 0.25
44 0.25
45 0.28
46 0.35
47 0.38
48 0.35
49 0.38
50 0.41
51 0.46
52 0.5
53 0.54
54 0.57
55 0.6
56 0.67
57 0.69
58 0.73
59 0.76
60 0.81
61 0.83
62 0.75
63 0.67
64 0.61
65 0.64