Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W3K6

Protein Details
Accession A0A2N5W3K6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
195-221EEFSKERKPEVKPKPRGQPRKDVLKDABasic
NLS Segment(s)
PositionSequence
199-228KERKPEVKPKPRGQPRKDVLKDAAKRMKKN
Subcellular Location(s) nucl 15, cyto_nucl 11.333, mito_nucl 10.833, cyto 6.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSLTRMPNHPSTPDCVRANQYGNVTTKSFVQCAGALNSKEEDFEIRLTTNTALNNLLDPLNIYYVSEREEVVSNANKGATHLNVIMTHNDWDAQEQCYRRFSVKYMVPGTKLQVKTFSLFAVGRLTCVGHYKKSDWLPCSPNDPNATATSSRPATPGPFARAKRTSAVAVTKGKGKATVPLDEESDGIETESEPEEFSKERKPEVKPKPRGQPRKDVLKDAAKRMKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.44
4 0.45
5 0.47
6 0.45
7 0.42
8 0.4
9 0.41
10 0.4
11 0.36
12 0.31
13 0.33
14 0.31
15 0.28
16 0.22
17 0.21
18 0.19
19 0.21
20 0.25
21 0.26
22 0.23
23 0.25
24 0.26
25 0.24
26 0.23
27 0.2
28 0.18
29 0.14
30 0.15
31 0.14
32 0.13
33 0.14
34 0.15
35 0.15
36 0.16
37 0.14
38 0.14
39 0.14
40 0.13
41 0.13
42 0.13
43 0.12
44 0.09
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.09
52 0.11
53 0.11
54 0.1
55 0.1
56 0.12
57 0.12
58 0.15
59 0.17
60 0.15
61 0.15
62 0.16
63 0.14
64 0.14
65 0.15
66 0.12
67 0.11
68 0.11
69 0.11
70 0.12
71 0.14
72 0.14
73 0.12
74 0.13
75 0.11
76 0.11
77 0.1
78 0.1
79 0.11
80 0.11
81 0.14
82 0.15
83 0.17
84 0.18
85 0.19
86 0.19
87 0.19
88 0.19
89 0.23
90 0.24
91 0.29
92 0.31
93 0.31
94 0.32
95 0.31
96 0.31
97 0.31
98 0.29
99 0.23
100 0.22
101 0.21
102 0.2
103 0.2
104 0.18
105 0.13
106 0.13
107 0.13
108 0.14
109 0.12
110 0.11
111 0.11
112 0.11
113 0.09
114 0.14
115 0.15
116 0.14
117 0.16
118 0.18
119 0.23
120 0.29
121 0.33
122 0.31
123 0.35
124 0.36
125 0.35
126 0.4
127 0.36
128 0.35
129 0.32
130 0.31
131 0.27
132 0.25
133 0.27
134 0.21
135 0.2
136 0.2
137 0.19
138 0.18
139 0.17
140 0.17
141 0.16
142 0.19
143 0.22
144 0.23
145 0.3
146 0.31
147 0.38
148 0.4
149 0.4
150 0.38
151 0.37
152 0.33
153 0.3
154 0.32
155 0.31
156 0.32
157 0.31
158 0.34
159 0.33
160 0.32
161 0.3
162 0.26
163 0.28
164 0.27
165 0.31
166 0.28
167 0.28
168 0.29
169 0.27
170 0.27
171 0.2
172 0.18
173 0.13
174 0.1
175 0.08
176 0.07
177 0.08
178 0.09
179 0.09
180 0.08
181 0.09
182 0.11
183 0.12
184 0.15
185 0.22
186 0.23
187 0.3
188 0.36
189 0.44
190 0.52
191 0.62
192 0.7
193 0.72
194 0.79
195 0.83
196 0.88
197 0.91
198 0.88
199 0.87
200 0.85
201 0.86
202 0.81
203 0.77
204 0.73
205 0.73
206 0.72
207 0.71
208 0.73