Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W7W5

Protein Details
Accession A0A2N5W7W5    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKGSPHQRRKRFNHPTRLSQYVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.166, cyto_nucl 9.666, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040223  PAR_bZIP  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MAKGSPHQRRKRFNHPTRLSQYVRSLQFTWGDSRLPGKSSATLFCKILQSCPLLENIDISNKFLLTCKESILEALASKPFIKEFVLSHDTNRTSLTFQWPPAEIVSRLFSHWNLLETVELSALSGCPHESNPSTQPAPNSIPVLNCAIRTMILVNHELDELTVSNLLKSCGESMRTLHITGPHTHLNPEAFGRVLQDSICPNLECLIVRAAGHWVHWKDPIFDCDLDEPFTGPGLLDTVFDSPTALRNLKTLSFHGSKMATNRLLDRLPKSLIKLSMERSRIAASPLINTLTISSGHNESLLPNLKCLSVHNPRNWNSKQENAVRVVMEMREGCAHIFRDMFFRTPSPSDRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.88
4 0.84
5 0.85
6 0.77
7 0.71
8 0.69
9 0.66
10 0.62
11 0.56
12 0.5
13 0.45
14 0.45
15 0.41
16 0.38
17 0.31
18 0.29
19 0.25
20 0.28
21 0.27
22 0.25
23 0.25
24 0.23
25 0.25
26 0.27
27 0.32
28 0.33
29 0.33
30 0.33
31 0.33
32 0.37
33 0.33
34 0.33
35 0.31
36 0.29
37 0.27
38 0.27
39 0.27
40 0.22
41 0.21
42 0.2
43 0.17
44 0.23
45 0.21
46 0.22
47 0.2
48 0.19
49 0.19
50 0.19
51 0.21
52 0.18
53 0.18
54 0.18
55 0.18
56 0.18
57 0.19
58 0.18
59 0.16
60 0.12
61 0.13
62 0.13
63 0.12
64 0.13
65 0.13
66 0.11
67 0.11
68 0.12
69 0.12
70 0.11
71 0.18
72 0.24
73 0.23
74 0.25
75 0.31
76 0.31
77 0.3
78 0.3
79 0.23
80 0.2
81 0.22
82 0.27
83 0.23
84 0.24
85 0.26
86 0.26
87 0.26
88 0.25
89 0.26
90 0.19
91 0.18
92 0.19
93 0.17
94 0.17
95 0.17
96 0.16
97 0.16
98 0.17
99 0.16
100 0.13
101 0.13
102 0.12
103 0.11
104 0.11
105 0.08
106 0.07
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.09
116 0.1
117 0.14
118 0.16
119 0.21
120 0.22
121 0.23
122 0.23
123 0.25
124 0.26
125 0.24
126 0.24
127 0.2
128 0.19
129 0.19
130 0.22
131 0.18
132 0.15
133 0.14
134 0.12
135 0.11
136 0.11
137 0.1
138 0.08
139 0.09
140 0.1
141 0.1
142 0.1
143 0.1
144 0.09
145 0.08
146 0.07
147 0.06
148 0.05
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.07
156 0.08
157 0.08
158 0.1
159 0.1
160 0.11
161 0.15
162 0.16
163 0.16
164 0.15
165 0.18
166 0.19
167 0.2
168 0.22
169 0.21
170 0.2
171 0.2
172 0.21
173 0.17
174 0.15
175 0.14
176 0.11
177 0.08
178 0.08
179 0.09
180 0.08
181 0.08
182 0.07
183 0.08
184 0.08
185 0.1
186 0.11
187 0.09
188 0.09
189 0.1
190 0.1
191 0.09
192 0.09
193 0.09
194 0.08
195 0.08
196 0.09
197 0.1
198 0.09
199 0.1
200 0.15
201 0.15
202 0.16
203 0.19
204 0.2
205 0.21
206 0.23
207 0.24
208 0.22
209 0.21
210 0.21
211 0.2
212 0.2
213 0.18
214 0.17
215 0.15
216 0.12
217 0.12
218 0.1
219 0.07
220 0.06
221 0.05
222 0.06
223 0.05
224 0.06
225 0.07
226 0.07
227 0.07
228 0.08
229 0.07
230 0.1
231 0.13
232 0.14
233 0.13
234 0.15
235 0.17
236 0.19
237 0.21
238 0.19
239 0.23
240 0.24
241 0.24
242 0.26
243 0.25
244 0.25
245 0.26
246 0.31
247 0.27
248 0.25
249 0.27
250 0.28
251 0.29
252 0.31
253 0.31
254 0.29
255 0.29
256 0.3
257 0.31
258 0.32
259 0.33
260 0.33
261 0.34
262 0.36
263 0.4
264 0.4
265 0.38
266 0.34
267 0.33
268 0.3
269 0.28
270 0.26
271 0.19
272 0.19
273 0.2
274 0.19
275 0.17
276 0.16
277 0.15
278 0.13
279 0.13
280 0.12
281 0.12
282 0.13
283 0.13
284 0.13
285 0.13
286 0.12
287 0.18
288 0.25
289 0.23
290 0.23
291 0.24
292 0.24
293 0.24
294 0.27
295 0.28
296 0.31
297 0.39
298 0.45
299 0.54
300 0.59
301 0.68
302 0.68
303 0.68
304 0.63
305 0.62
306 0.63
307 0.62
308 0.62
309 0.57
310 0.57
311 0.48
312 0.44
313 0.39
314 0.3
315 0.26
316 0.21
317 0.18
318 0.17
319 0.17
320 0.17
321 0.19
322 0.21
323 0.19
324 0.2
325 0.19
326 0.23
327 0.25
328 0.27
329 0.25
330 0.26
331 0.29
332 0.33
333 0.36