Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W360

Protein Details
Accession A0A2N5W360    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MVPRTLPKRLRERLRTNVSSRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 11.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVPRTLPKRLRERLRTNVSSRLSEGVLTTLRRCPHNAFSWKASGGRGQFLENRPVVHLASEGCLFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.75
4 0.74
5 0.66
6 0.58
7 0.5
8 0.42
9 0.32
10 0.26
11 0.22
12 0.15
13 0.14
14 0.13
15 0.13
16 0.15
17 0.17
18 0.18
19 0.2
20 0.21
21 0.24
22 0.31
23 0.35
24 0.35
25 0.36
26 0.37
27 0.36
28 0.34
29 0.3
30 0.26
31 0.22
32 0.22
33 0.2
34 0.2
35 0.24
36 0.26
37 0.32
38 0.29
39 0.28
40 0.27
41 0.28
42 0.25
43 0.2
44 0.19
45 0.14
46 0.15