Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SAV2

Protein Details
Accession A0A2N5SAV2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
132-186VTAATTRKPKRLRKEINAANNLAAAKRTKKARKAAKTAKAKRQKLEQKEARATLKHydrophilic
NLS Segment(s)
PositionSequence
138-180RKPKRLRKEINAANNLAAAKRTKKARKAAKTAKAKRQKLEQKE
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MTAFRTPTLAIPYPIYRPNSGYPPSNGNDLGSEYHPNSSDCNEYVVHNQHIHYDANGPLPDPVELINRHTQIGIGQGEIHAGLPSLDRAYVQSQSALDPATANVPLSGRAPCLLAPAKRTLKQLVAKKAQIVTAATTRKPKRLRKEINAANNLAAAKRTKKARKAAKTAKAKRQKLEQKEARATLKSSASAAATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.33
4 0.34
5 0.37
6 0.4
7 0.4
8 0.4
9 0.38
10 0.4
11 0.4
12 0.4
13 0.36
14 0.29
15 0.27
16 0.24
17 0.23
18 0.19
19 0.21
20 0.18
21 0.2
22 0.2
23 0.2
24 0.2
25 0.19
26 0.21
27 0.17
28 0.19
29 0.17
30 0.18
31 0.23
32 0.26
33 0.27
34 0.25
35 0.25
36 0.25
37 0.27
38 0.25
39 0.2
40 0.18
41 0.16
42 0.18
43 0.18
44 0.16
45 0.14
46 0.14
47 0.14
48 0.11
49 0.11
50 0.11
51 0.12
52 0.15
53 0.2
54 0.2
55 0.2
56 0.2
57 0.19
58 0.15
59 0.19
60 0.15
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.06
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.1
82 0.1
83 0.09
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.07
99 0.11
100 0.14
101 0.14
102 0.16
103 0.23
104 0.28
105 0.3
106 0.33
107 0.31
108 0.34
109 0.4
110 0.45
111 0.47
112 0.48
113 0.46
114 0.47
115 0.46
116 0.4
117 0.34
118 0.28
119 0.21
120 0.22
121 0.23
122 0.23
123 0.31
124 0.32
125 0.39
126 0.47
127 0.54
128 0.58
129 0.66
130 0.74
131 0.74
132 0.83
133 0.83
134 0.84
135 0.8
136 0.71
137 0.6
138 0.52
139 0.43
140 0.32
141 0.26
142 0.19
143 0.18
144 0.22
145 0.32
146 0.38
147 0.46
148 0.56
149 0.65
150 0.71
151 0.79
152 0.84
153 0.84
154 0.87
155 0.89
156 0.89
157 0.89
158 0.86
159 0.81
160 0.82
161 0.82
162 0.81
163 0.82
164 0.8
165 0.79
166 0.81
167 0.81
168 0.75
169 0.68
170 0.6
171 0.54
172 0.49
173 0.4
174 0.33
175 0.29