Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5V8V9

Protein Details
Accession A0A2N5V8V9    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPHTNSKEWLKRNKLPSKKPSGAKNPSGSHydrophilic
207-256RGLSKTSKPKSNNKTNKKKKIPYESKATRSIERVKKQAKRDSKSKKASAPHydrophilic
NLS Segment(s)
PositionSequence
11-27KRNKLPSKKPSGAKNPS
58-75RKKAGKAAALERASQRAR
203-253DNKPRGLSKTSKPKSNNKTNKKKKIPYESKATRSIERVKKQAKRDSKSKKA
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MPHTNSKEWLKRNKLPSKKPSGAKNPSGSTGFKLARRPRLVEYDEKDRYEYLTGFSARKKAGKAAALERASQRAREEKLEFRRQLKDARLSKIKEAIDQQTEWYGIDAFEGQQNLETGGQVKPTRVVEKFVEKSADGAVSQSHTTTTVTIEPLEVDHSVLMANPDTRAPASSHSHYQPHPDRNFHKISSSSSTPKPPPHDRTDNKPRGLSKTSKPKSNNKTNKKKKIPYESKATRSIERVKKQAKRDSKSKKASAPLSADCCTSLNCAKIAAHRVRLLVLPPWGGDTPREDAGEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.87
4 0.87
5 0.86
6 0.84
7 0.84
8 0.84
9 0.83
10 0.81
11 0.79
12 0.71
13 0.67
14 0.63
15 0.54
16 0.47
17 0.45
18 0.41
19 0.37
20 0.44
21 0.47
22 0.54
23 0.57
24 0.58
25 0.55
26 0.59
27 0.6
28 0.6
29 0.57
30 0.57
31 0.57
32 0.54
33 0.51
34 0.42
35 0.4
36 0.34
37 0.29
38 0.21
39 0.21
40 0.22
41 0.23
42 0.26
43 0.29
44 0.29
45 0.32
46 0.31
47 0.31
48 0.34
49 0.36
50 0.38
51 0.38
52 0.45
53 0.43
54 0.44
55 0.4
56 0.41
57 0.37
58 0.34
59 0.32
60 0.29
61 0.3
62 0.34
63 0.36
64 0.39
65 0.47
66 0.55
67 0.57
68 0.55
69 0.58
70 0.55
71 0.58
72 0.55
73 0.56
74 0.52
75 0.55
76 0.58
77 0.54
78 0.54
79 0.55
80 0.48
81 0.42
82 0.4
83 0.38
84 0.33
85 0.31
86 0.29
87 0.24
88 0.23
89 0.2
90 0.16
91 0.11
92 0.08
93 0.08
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.11
107 0.11
108 0.11
109 0.14
110 0.15
111 0.19
112 0.18
113 0.21
114 0.2
115 0.28
116 0.29
117 0.28
118 0.27
119 0.23
120 0.23
121 0.2
122 0.18
123 0.1
124 0.09
125 0.07
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.07
132 0.07
133 0.08
134 0.07
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.08
141 0.07
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.08
156 0.11
157 0.16
158 0.18
159 0.22
160 0.24
161 0.27
162 0.27
163 0.35
164 0.38
165 0.43
166 0.44
167 0.46
168 0.47
169 0.5
170 0.53
171 0.45
172 0.42
173 0.35
174 0.35
175 0.34
176 0.35
177 0.34
178 0.33
179 0.38
180 0.39
181 0.42
182 0.46
183 0.49
184 0.51
185 0.55
186 0.63
187 0.61
188 0.67
189 0.73
190 0.74
191 0.68
192 0.66
193 0.6
194 0.56
195 0.58
196 0.54
197 0.52
198 0.55
199 0.56
200 0.6
201 0.63
202 0.67
203 0.71
204 0.76
205 0.78
206 0.78
207 0.85
208 0.88
209 0.92
210 0.93
211 0.92
212 0.9
213 0.91
214 0.9
215 0.85
216 0.85
217 0.83
218 0.78
219 0.77
220 0.71
221 0.63
222 0.58
223 0.62
224 0.61
225 0.59
226 0.63
227 0.64
228 0.68
229 0.74
230 0.78
231 0.78
232 0.76
233 0.8
234 0.81
235 0.82
236 0.85
237 0.83
238 0.8
239 0.78
240 0.75
241 0.72
242 0.68
243 0.63
244 0.59
245 0.53
246 0.46
247 0.38
248 0.34
249 0.28
250 0.26
251 0.23
252 0.2
253 0.19
254 0.2
255 0.21
256 0.26
257 0.34
258 0.36
259 0.38
260 0.39
261 0.39
262 0.39
263 0.39
264 0.36
265 0.31
266 0.28
267 0.23
268 0.21
269 0.24
270 0.24
271 0.23
272 0.22
273 0.22
274 0.23
275 0.25