Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0SXA6

Protein Details
Accession G0SXA6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
458-481DEDDETRARNRRRRAEEGRPKVGEBasic
NLS Segment(s)
PositionSequence
465-480ARNRRRRAEEGRPKVG
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
Amino Acid Sequences MSNGKSPVNDDEKGPQGKIAPFWVESNPHRPAQSHRSASSGNSFFGRIGLAQPSLRISTIEDVFFVHPAAEGVPTDSERLRGHVSLWLPKARSIKDLSVRFFARYDIAWPDTTPYESGVCLERTVSLVNDGEEMQLDKGEHTFEFIVHIPPSTPPYERSIYGRVRAGCQAVARSLGPLGSDLLTPERRIYICVNPGLEEQSRPPPPLNLRMVGETDEFGPYAFKFQSQYAMVGGLVLLKMHFLAPNTELVVHAVRVKVLQTSELQSPATGHSCTTKPFVQPVFTLDALHPPNNASLAPAPSSAPLSPSLASPSTSSPPLFTLTPGTEYRLRHLGRLPNDNGVRPTTQEGTDTPIRMRHDMQIEVVWSRGGEEGERKKTILTQRLNIFSCACFFDSLTLPLYSPTDPNPMTDNTRILIPCVCGMPFRRLVEEHGSSLVRRHASRTAEEGAAVSEESDSDEDDETRARNRRRRAEEGRPKVGELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.35
4 0.37
5 0.37
6 0.35
7 0.31
8 0.29
9 0.31
10 0.33
11 0.34
12 0.36
13 0.42
14 0.41
15 0.41
16 0.41
17 0.4
18 0.45
19 0.47
20 0.53
21 0.52
22 0.49
23 0.5
24 0.5
25 0.51
26 0.52
27 0.44
28 0.35
29 0.3
30 0.29
31 0.25
32 0.24
33 0.22
34 0.13
35 0.13
36 0.15
37 0.16
38 0.15
39 0.16
40 0.18
41 0.19
42 0.18
43 0.16
44 0.16
45 0.19
46 0.21
47 0.2
48 0.18
49 0.19
50 0.19
51 0.19
52 0.17
53 0.11
54 0.09
55 0.09
56 0.09
57 0.08
58 0.07
59 0.08
60 0.1
61 0.11
62 0.13
63 0.13
64 0.16
65 0.16
66 0.19
67 0.21
68 0.19
69 0.2
70 0.23
71 0.26
72 0.29
73 0.33
74 0.35
75 0.33
76 0.38
77 0.43
78 0.39
79 0.41
80 0.38
81 0.41
82 0.45
83 0.5
84 0.49
85 0.49
86 0.48
87 0.45
88 0.41
89 0.34
90 0.27
91 0.21
92 0.21
93 0.19
94 0.2
95 0.19
96 0.19
97 0.2
98 0.2
99 0.21
100 0.18
101 0.15
102 0.13
103 0.12
104 0.14
105 0.14
106 0.13
107 0.12
108 0.12
109 0.11
110 0.11
111 0.12
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.11
118 0.1
119 0.1
120 0.1
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.08
128 0.1
129 0.1
130 0.09
131 0.11
132 0.12
133 0.14
134 0.13
135 0.13
136 0.11
137 0.12
138 0.16
139 0.15
140 0.15
141 0.15
142 0.2
143 0.22
144 0.23
145 0.26
146 0.3
147 0.31
148 0.34
149 0.36
150 0.32
151 0.32
152 0.33
153 0.3
154 0.24
155 0.22
156 0.2
157 0.16
158 0.16
159 0.14
160 0.12
161 0.11
162 0.09
163 0.08
164 0.07
165 0.08
166 0.07
167 0.07
168 0.07
169 0.11
170 0.12
171 0.12
172 0.12
173 0.13
174 0.13
175 0.15
176 0.18
177 0.19
178 0.22
179 0.23
180 0.23
181 0.22
182 0.22
183 0.23
184 0.21
185 0.17
186 0.15
187 0.21
188 0.22
189 0.22
190 0.22
191 0.23
192 0.26
193 0.33
194 0.33
195 0.28
196 0.28
197 0.28
198 0.28
199 0.25
200 0.22
201 0.14
202 0.12
203 0.1
204 0.09
205 0.07
206 0.07
207 0.06
208 0.08
209 0.08
210 0.08
211 0.09
212 0.09
213 0.13
214 0.13
215 0.14
216 0.12
217 0.12
218 0.11
219 0.09
220 0.09
221 0.05
222 0.04
223 0.04
224 0.03
225 0.03
226 0.03
227 0.03
228 0.04
229 0.04
230 0.06
231 0.07
232 0.08
233 0.08
234 0.08
235 0.08
236 0.08
237 0.08
238 0.07
239 0.08
240 0.07
241 0.07
242 0.07
243 0.08
244 0.08
245 0.08
246 0.09
247 0.09
248 0.12
249 0.13
250 0.13
251 0.13
252 0.12
253 0.12
254 0.12
255 0.13
256 0.1
257 0.09
258 0.11
259 0.12
260 0.14
261 0.17
262 0.18
263 0.17
264 0.22
265 0.23
266 0.22
267 0.21
268 0.22
269 0.23
270 0.2
271 0.2
272 0.15
273 0.2
274 0.2
275 0.2
276 0.18
277 0.15
278 0.15
279 0.15
280 0.14
281 0.1
282 0.09
283 0.1
284 0.11
285 0.11
286 0.11
287 0.11
288 0.13
289 0.11
290 0.11
291 0.1
292 0.11
293 0.11
294 0.11
295 0.13
296 0.12
297 0.13
298 0.13
299 0.15
300 0.15
301 0.17
302 0.17
303 0.15
304 0.15
305 0.17
306 0.16
307 0.14
308 0.15
309 0.14
310 0.18
311 0.17
312 0.2
313 0.22
314 0.23
315 0.25
316 0.3
317 0.29
318 0.28
319 0.33
320 0.37
321 0.38
322 0.45
323 0.44
324 0.43
325 0.45
326 0.44
327 0.4
328 0.36
329 0.31
330 0.25
331 0.26
332 0.21
333 0.2
334 0.19
335 0.18
336 0.21
337 0.24
338 0.24
339 0.22
340 0.24
341 0.26
342 0.27
343 0.28
344 0.28
345 0.28
346 0.28
347 0.28
348 0.25
349 0.24
350 0.22
351 0.2
352 0.15
353 0.11
354 0.11
355 0.11
356 0.09
357 0.09
358 0.17
359 0.25
360 0.31
361 0.32
362 0.32
363 0.31
364 0.37
365 0.43
366 0.45
367 0.42
368 0.44
369 0.49
370 0.56
371 0.57
372 0.52
373 0.45
374 0.36
375 0.32
376 0.28
377 0.22
378 0.16
379 0.15
380 0.16
381 0.16
382 0.17
383 0.18
384 0.16
385 0.15
386 0.15
387 0.18
388 0.16
389 0.15
390 0.16
391 0.21
392 0.21
393 0.22
394 0.25
395 0.26
396 0.3
397 0.32
398 0.31
399 0.24
400 0.29
401 0.27
402 0.25
403 0.24
404 0.2
405 0.19
406 0.19
407 0.18
408 0.17
409 0.2
410 0.26
411 0.3
412 0.3
413 0.32
414 0.32
415 0.37
416 0.41
417 0.41
418 0.36
419 0.33
420 0.33
421 0.29
422 0.31
423 0.32
424 0.29
425 0.27
426 0.29
427 0.32
428 0.35
429 0.39
430 0.41
431 0.39
432 0.35
433 0.34
434 0.31
435 0.25
436 0.21
437 0.17
438 0.12
439 0.08
440 0.07
441 0.09
442 0.09
443 0.09
444 0.1
445 0.11
446 0.11
447 0.12
448 0.15
449 0.15
450 0.22
451 0.3
452 0.38
453 0.45
454 0.55
455 0.64
456 0.71
457 0.8
458 0.82
459 0.85
460 0.87
461 0.88
462 0.88
463 0.8