Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W4A9

Protein Details
Accession A0A2N5W4A9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
197-222KEEPVESPPPKKPQRCPRNNILKAAAHydrophilic
NLS Segment(s)
PositionSequence
216-228NILKAAAKRMKRA
Subcellular Location(s) mito 13.5, cyto 11.5, mito_nucl 8.333, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGKIITSADGKPPTITYNQGSAVPVATSEGASLDMMNRVGIVGLGKVFSSTEVITEGGEGPTALEVVVNHNDWDPRNLQGTFKIYQPGREVQITGKVVDFDMTDHMMVVLLPVATEPSGGFHKQAPLSDRPPSQGKTCKATVKFDSGLKGKAPTETARKATTSPSAFMKVGSPAKLGKVSTEDDKYSSGESAEEYNKEEPVESPPPKKPQRCPRNNILKAAAKRMKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.25
4 0.26
5 0.27
6 0.28
7 0.27
8 0.24
9 0.22
10 0.18
11 0.15
12 0.11
13 0.1
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.08
20 0.07
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.07
38 0.07
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.07
45 0.07
46 0.07
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.08
54 0.1
55 0.1
56 0.11
57 0.12
58 0.14
59 0.14
60 0.17
61 0.14
62 0.14
63 0.18
64 0.18
65 0.18
66 0.2
67 0.23
68 0.22
69 0.22
70 0.26
71 0.22
72 0.24
73 0.27
74 0.26
75 0.24
76 0.24
77 0.23
78 0.18
79 0.25
80 0.23
81 0.2
82 0.17
83 0.15
84 0.14
85 0.14
86 0.13
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.06
106 0.07
107 0.08
108 0.09
109 0.12
110 0.13
111 0.15
112 0.17
113 0.2
114 0.23
115 0.27
116 0.27
117 0.27
118 0.3
119 0.3
120 0.32
121 0.35
122 0.35
123 0.36
124 0.39
125 0.42
126 0.41
127 0.44
128 0.41
129 0.39
130 0.38
131 0.35
132 0.36
133 0.31
134 0.31
135 0.26
136 0.26
137 0.21
138 0.2
139 0.21
140 0.21
141 0.26
142 0.29
143 0.31
144 0.3
145 0.31
146 0.3
147 0.31
148 0.34
149 0.29
150 0.26
151 0.26
152 0.28
153 0.27
154 0.26
155 0.24
156 0.23
157 0.25
158 0.24
159 0.22
160 0.19
161 0.22
162 0.24
163 0.23
164 0.19
165 0.19
166 0.21
167 0.25
168 0.27
169 0.26
170 0.25
171 0.26
172 0.25
173 0.23
174 0.21
175 0.15
176 0.12
177 0.12
178 0.15
179 0.16
180 0.16
181 0.19
182 0.19
183 0.2
184 0.2
185 0.2
186 0.16
187 0.21
188 0.29
189 0.31
190 0.36
191 0.42
192 0.52
193 0.62
194 0.69
195 0.72
196 0.74
197 0.8
198 0.85
199 0.86
200 0.86
201 0.88
202 0.86
203 0.82
204 0.79
205 0.77
206 0.7
207 0.73
208 0.69