Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5UQ71

Protein Details
Accession A0A2N5UQ71   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-83TPTPSLVQKKKKSPKKSLSKVMHQSKQLHydrophilic
NLS Segment(s)
PositionSequence
64-72KKKKSPKKS
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MFLSRDGTANPDSAGSHAAANATNHKKAVVAVEKANKTPPYDLSTISWPSRQIKLTPTPSLVQKKKKSPKKSLSKVMHQSKQLLKLTHGDESFNMEVGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.1
4 0.1
5 0.1
6 0.11
7 0.12
8 0.2
9 0.23
10 0.23
11 0.23
12 0.23
13 0.23
14 0.22
15 0.27
16 0.24
17 0.23
18 0.27
19 0.34
20 0.35
21 0.35
22 0.39
23 0.33
24 0.29
25 0.28
26 0.26
27 0.23
28 0.23
29 0.23
30 0.2
31 0.23
32 0.24
33 0.23
34 0.21
35 0.19
36 0.21
37 0.22
38 0.22
39 0.2
40 0.21
41 0.28
42 0.32
43 0.32
44 0.32
45 0.3
46 0.36
47 0.44
48 0.47
49 0.49
50 0.51
51 0.6
52 0.68
53 0.76
54 0.79
55 0.8
56 0.83
57 0.85
58 0.87
59 0.88
60 0.85
61 0.86
62 0.86
63 0.85
64 0.81
65 0.72
66 0.7
67 0.65
68 0.66
69 0.61
70 0.53
71 0.45
72 0.45
73 0.45
74 0.44
75 0.39
76 0.32
77 0.27
78 0.32
79 0.31