Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0T129

Protein Details
Accession G0T129   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-60ATTAPRPTAKRRRSSLKQGSAMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012336  Thioredoxin-like_fold  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF13905  Thioredoxin_8  
Amino Acid Sequences MPSTLDTPADSLPTPNSPSQKTVSFDESPSSSSSALPPATTAPRPTAKRRRSSLKQGSAMPYRPPKETYAHPDPLIRRLRLRDGYGNEVNLVNEFREAKVVLFFFGATWPGSVREPFDLVSAFARRHPHQCKVVYVSVDSDEASYEANTRQQPWLAMEWNDGSNMSTPLPTPDTPAEPQTPLEPFLLAGDPDLEDEVHHSDPKGELYLRPYSRVYLADTWNVLGVPNLLVYHLPTAKILNHHARFEFLKEGKAEQAWEKWSKGEKIEYGVGDFIYALRWTLGFAVVAVAYMVGVRQGVVPDVVSDVSESLTRNYIFKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.33
4 0.33
5 0.36
6 0.39
7 0.41
8 0.41
9 0.41
10 0.43
11 0.39
12 0.37
13 0.37
14 0.35
15 0.31
16 0.29
17 0.26
18 0.2
19 0.18
20 0.19
21 0.2
22 0.19
23 0.17
24 0.16
25 0.18
26 0.23
27 0.25
28 0.25
29 0.26
30 0.34
31 0.4
32 0.49
33 0.56
34 0.6
35 0.67
36 0.73
37 0.77
38 0.78
39 0.84
40 0.84
41 0.83
42 0.79
43 0.75
44 0.74
45 0.71
46 0.64
47 0.61
48 0.58
49 0.51
50 0.49
51 0.46
52 0.42
53 0.4
54 0.44
55 0.46
56 0.45
57 0.47
58 0.45
59 0.48
60 0.47
61 0.51
62 0.51
63 0.45
64 0.41
65 0.41
66 0.48
67 0.47
68 0.49
69 0.48
70 0.45
71 0.5
72 0.47
73 0.43
74 0.36
75 0.32
76 0.28
77 0.21
78 0.18
79 0.11
80 0.1
81 0.1
82 0.09
83 0.11
84 0.11
85 0.1
86 0.12
87 0.12
88 0.11
89 0.1
90 0.1
91 0.09
92 0.09
93 0.09
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.1
100 0.1
101 0.11
102 0.11
103 0.11
104 0.12
105 0.11
106 0.1
107 0.12
108 0.13
109 0.12
110 0.14
111 0.19
112 0.2
113 0.29
114 0.33
115 0.37
116 0.42
117 0.44
118 0.44
119 0.45
120 0.46
121 0.38
122 0.33
123 0.28
124 0.22
125 0.2
126 0.16
127 0.11
128 0.08
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.1
135 0.11
136 0.12
137 0.13
138 0.13
139 0.14
140 0.15
141 0.16
142 0.14
143 0.14
144 0.14
145 0.14
146 0.13
147 0.13
148 0.11
149 0.09
150 0.08
151 0.08
152 0.07
153 0.07
154 0.06
155 0.08
156 0.11
157 0.11
158 0.13
159 0.13
160 0.16
161 0.17
162 0.2
163 0.19
164 0.17
165 0.18
166 0.17
167 0.16
168 0.15
169 0.14
170 0.11
171 0.09
172 0.1
173 0.1
174 0.08
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.05
181 0.04
182 0.06
183 0.09
184 0.09
185 0.09
186 0.09
187 0.1
188 0.11
189 0.12
190 0.12
191 0.1
192 0.11
193 0.15
194 0.23
195 0.23
196 0.25
197 0.25
198 0.24
199 0.25
200 0.25
201 0.25
202 0.22
203 0.23
204 0.22
205 0.22
206 0.21
207 0.19
208 0.18
209 0.14
210 0.09
211 0.08
212 0.06
213 0.06
214 0.06
215 0.05
216 0.06
217 0.06
218 0.1
219 0.1
220 0.1
221 0.1
222 0.12
223 0.14
224 0.17
225 0.23
226 0.29
227 0.32
228 0.34
229 0.34
230 0.36
231 0.35
232 0.34
233 0.36
234 0.27
235 0.28
236 0.26
237 0.28
238 0.27
239 0.27
240 0.26
241 0.21
242 0.24
243 0.26
244 0.28
245 0.28
246 0.3
247 0.35
248 0.36
249 0.36
250 0.37
251 0.34
252 0.35
253 0.38
254 0.35
255 0.3
256 0.28
257 0.24
258 0.19
259 0.16
260 0.12
261 0.09
262 0.08
263 0.07
264 0.07
265 0.07
266 0.07
267 0.08
268 0.09
269 0.07
270 0.07
271 0.08
272 0.07
273 0.07
274 0.07
275 0.05
276 0.04
277 0.04
278 0.04
279 0.03
280 0.04
281 0.04
282 0.05
283 0.06
284 0.07
285 0.08
286 0.08
287 0.08
288 0.1
289 0.1
290 0.09
291 0.09
292 0.08
293 0.09
294 0.1
295 0.11
296 0.11
297 0.16
298 0.17
299 0.18