Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5VRL6

Protein Details
Accession A0A2N5VRL6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-48ETCGLAKRPIRRKKAKDGVKEELBasic
NLS Segment(s)
PositionSequence
32-41KRPIRRKKAK
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MQSSTQITSATASSVVEVDGKTYGEETCGLAKRPIRRKKAKDGVKEELVSLDLLKKMSTAHSTISNTAKKQNDILEAQQVAITRKANKAIMSKDLTGLSDLAQSYYESEQKKIIEQLQNKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.08
12 0.09
13 0.1
14 0.14
15 0.16
16 0.18
17 0.21
18 0.25
19 0.33
20 0.43
21 0.51
22 0.55
23 0.64
24 0.7
25 0.77
26 0.83
27 0.83
28 0.83
29 0.81
30 0.78
31 0.72
32 0.65
33 0.54
34 0.44
35 0.35
36 0.25
37 0.18
38 0.12
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.09
45 0.1
46 0.1
47 0.1
48 0.14
49 0.15
50 0.17
51 0.23
52 0.24
53 0.23
54 0.28
55 0.29
56 0.26
57 0.27
58 0.27
59 0.25
60 0.24
61 0.25
62 0.23
63 0.21
64 0.2
65 0.19
66 0.18
67 0.16
68 0.16
69 0.17
70 0.15
71 0.17
72 0.21
73 0.22
74 0.24
75 0.28
76 0.29
77 0.33
78 0.35
79 0.33
80 0.32
81 0.31
82 0.27
83 0.23
84 0.2
85 0.14
86 0.13
87 0.12
88 0.11
89 0.11
90 0.1
91 0.12
92 0.14
93 0.19
94 0.18
95 0.2
96 0.23
97 0.23
98 0.27
99 0.3
100 0.35
101 0.39
102 0.42