Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5SUP5

Protein Details
Accession A0A2N5SUP5    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-43TAQIQIPKRPTQNRPRPPRTKRPLNQAKPIGHydrophilic
NLS Segment(s)
PositionSequence
3-8RRKRGS
18-35IPKRPTQNRPRPPRTKRP
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MRRRKRGSLAKTTAQIQIPKRPTQNRPRPPRTKRPLNQAKPIGNAQGHCPAELPSTQTEPSAQNNSLELKSRKVTTDKPKDSNSLSTTTTQHSYHPTTPFPNIPIKLNHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.47
4 0.49
5 0.47
6 0.5
7 0.55
8 0.58
9 0.63
10 0.68
11 0.74
12 0.75
13 0.81
14 0.85
15 0.88
16 0.89
17 0.91
18 0.89
19 0.89
20 0.85
21 0.86
22 0.86
23 0.83
24 0.83
25 0.79
26 0.72
27 0.64
28 0.59
29 0.52
30 0.42
31 0.35
32 0.28
33 0.29
34 0.26
35 0.22
36 0.21
37 0.18
38 0.18
39 0.17
40 0.17
41 0.1
42 0.12
43 0.12
44 0.12
45 0.12
46 0.13
47 0.16
48 0.18
49 0.17
50 0.15
51 0.17
52 0.19
53 0.18
54 0.22
55 0.2
56 0.2
57 0.22
58 0.23
59 0.25
60 0.27
61 0.35
62 0.4
63 0.5
64 0.54
65 0.57
66 0.59
67 0.61
68 0.59
69 0.57
70 0.49
71 0.41
72 0.36
73 0.33
74 0.32
75 0.31
76 0.32
77 0.26
78 0.25
79 0.28
80 0.32
81 0.34
82 0.36
83 0.37
84 0.37
85 0.41
86 0.42
87 0.4
88 0.43
89 0.39
90 0.4