Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5T1J3

Protein Details
Accession A0A2N5T1J3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-100DPETSPKAGKPKQGRKKRSGKVLLAMHydrophilic
NLS Segment(s)
PositionSequence
81-95KAGKPKQGRKKRSGK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences VTRYCNHNIATTQYDSEQSPECPIQQPLPMAAPLHKAAIANLSSSPVIKRTCKSRGTVPQLENKDSSSQSDTSPDPETSPKAGKPKQGRKKRSGKVLLAMPSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.25
4 0.22
5 0.18
6 0.2
7 0.19
8 0.2
9 0.21
10 0.22
11 0.22
12 0.23
13 0.23
14 0.2
15 0.2
16 0.19
17 0.17
18 0.16
19 0.17
20 0.15
21 0.15
22 0.14
23 0.12
24 0.11
25 0.14
26 0.13
27 0.11
28 0.1
29 0.11
30 0.1
31 0.1
32 0.11
33 0.11
34 0.13
35 0.15
36 0.17
37 0.21
38 0.28
39 0.31
40 0.33
41 0.37
42 0.44
43 0.5
44 0.56
45 0.52
46 0.53
47 0.54
48 0.54
49 0.46
50 0.38
51 0.33
52 0.26
53 0.26
54 0.21
55 0.19
56 0.18
57 0.2
58 0.19
59 0.19
60 0.22
61 0.2
62 0.18
63 0.2
64 0.22
65 0.23
66 0.26
67 0.27
68 0.34
69 0.37
70 0.45
71 0.53
72 0.61
73 0.68
74 0.76
75 0.81
76 0.81
77 0.89
78 0.88
79 0.88
80 0.87
81 0.82
82 0.78
83 0.76