Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5UB19

Protein Details
Accession A0A2N5UB19    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MHKAQNESSKNKKRKRKPSIPPTSDKEPAHydrophilic
NLS Segment(s)
PositionSequence
10-19KNKKRKRKPS
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MHKAQNESSKNKKRKRKPSIPPTSDKEPAWPDSPALESNHGEASEHEELCGPIPLTIFNKKWKNTAIIHHAEKQSRFKDLSLDRNQYTGYPYHSEWTQTFSDWTINHQEFYLTMRDVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.91
4 0.92
5 0.93
6 0.95
7 0.92
8 0.89
9 0.84
10 0.8
11 0.74
12 0.63
13 0.58
14 0.5
15 0.46
16 0.4
17 0.34
18 0.27
19 0.24
20 0.25
21 0.22
22 0.19
23 0.19
24 0.17
25 0.18
26 0.18
27 0.17
28 0.15
29 0.13
30 0.18
31 0.18
32 0.17
33 0.16
34 0.15
35 0.15
36 0.15
37 0.16
38 0.09
39 0.07
40 0.07
41 0.08
42 0.1
43 0.15
44 0.16
45 0.23
46 0.28
47 0.29
48 0.32
49 0.33
50 0.35
51 0.33
52 0.37
53 0.37
54 0.37
55 0.39
56 0.42
57 0.44
58 0.42
59 0.42
60 0.43
61 0.37
62 0.35
63 0.33
64 0.28
65 0.32
66 0.34
67 0.41
68 0.42
69 0.46
70 0.43
71 0.43
72 0.43
73 0.36
74 0.33
75 0.25
76 0.21
77 0.19
78 0.19
79 0.21
80 0.21
81 0.24
82 0.22
83 0.25
84 0.22
85 0.19
86 0.2
87 0.18
88 0.22
89 0.19
90 0.22
91 0.27
92 0.27
93 0.27
94 0.26
95 0.25
96 0.21
97 0.24
98 0.24