Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SXD7

Protein Details
Accession G0SXD7   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-153LAPVSPTHRERRNERKRKEKIDSGASFFHydrophilic
NLS Segment(s)
PositionSequence
135-144ERRNERKRKE
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MKPQPPIEPGQAFSPPTANIRPEEGSYRRHHQYVERREPRPEQRPPPNAERCPAPPAMEDSHPRRDMHNYNFSRRQPLHDDEARHVTHQPDPYRYVEPEEKPAHAAVLQRSRMAHAIRNPSLTSILAPVSPTHRERRNERKRKEKIDSGASFFVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.25
4 0.26
5 0.24
6 0.22
7 0.25
8 0.26
9 0.26
10 0.32
11 0.31
12 0.34
13 0.37
14 0.43
15 0.43
16 0.42
17 0.42
18 0.44
19 0.52
20 0.56
21 0.62
22 0.63
23 0.62
24 0.66
25 0.72
26 0.72
27 0.71
28 0.69
29 0.67
30 0.69
31 0.74
32 0.75
33 0.76
34 0.76
35 0.69
36 0.62
37 0.56
38 0.49
39 0.45
40 0.4
41 0.32
42 0.23
43 0.25
44 0.26
45 0.25
46 0.27
47 0.28
48 0.34
49 0.35
50 0.35
51 0.33
52 0.36
53 0.39
54 0.41
55 0.46
56 0.42
57 0.46
58 0.52
59 0.52
60 0.53
61 0.47
62 0.44
63 0.4
64 0.4
65 0.4
66 0.37
67 0.38
68 0.33
69 0.38
70 0.33
71 0.28
72 0.26
73 0.22
74 0.22
75 0.26
76 0.26
77 0.24
78 0.27
79 0.29
80 0.3
81 0.29
82 0.31
83 0.31
84 0.3
85 0.34
86 0.33
87 0.31
88 0.29
89 0.29
90 0.24
91 0.2
92 0.21
93 0.19
94 0.25
95 0.26
96 0.26
97 0.26
98 0.27
99 0.3
100 0.28
101 0.28
102 0.26
103 0.34
104 0.35
105 0.38
106 0.36
107 0.33
108 0.33
109 0.28
110 0.22
111 0.15
112 0.13
113 0.11
114 0.12
115 0.12
116 0.14
117 0.19
118 0.23
119 0.29
120 0.36
121 0.43
122 0.52
123 0.62
124 0.69
125 0.75
126 0.81
127 0.84
128 0.87
129 0.9
130 0.9
131 0.88
132 0.85
133 0.85
134 0.8
135 0.75