Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5U778

Protein Details
Accession A0A2N5U778    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-59QKDPGETESKKRRRKRKTKEEKVKKAQDLYBasic
NLS Segment(s)
PositionSequence
38-54SKKRRRKRKTKEEKVKK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028375  KA1/Ssp2_C  
Gene Ontology GO:0005524  F:ATP binding  
Amino Acid Sequences MLEIYQTLQMPGFEFKRKDTHSHTLKEPSQKDPGETESKKRRRKRKTKEEKVKKAQDLYFFKTCCRLDNVILYEIEVQDYLVYFRNLGYKLPPQTMSVQGEAAVNNTRHAASLGAVATSLPFLFLDCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.37
4 0.4
5 0.44
6 0.47
7 0.53
8 0.55
9 0.58
10 0.6
11 0.6
12 0.62
13 0.65
14 0.6
15 0.54
16 0.54
17 0.5
18 0.47
19 0.41
20 0.41
21 0.41
22 0.4
23 0.45
24 0.48
25 0.57
26 0.64
27 0.7
28 0.76
29 0.77
30 0.86
31 0.89
32 0.89
33 0.91
34 0.93
35 0.96
36 0.96
37 0.96
38 0.95
39 0.92
40 0.84
41 0.79
42 0.7
43 0.68
44 0.61
45 0.56
46 0.51
47 0.43
48 0.39
49 0.39
50 0.36
51 0.29
52 0.28
53 0.24
54 0.21
55 0.25
56 0.27
57 0.22
58 0.22
59 0.21
60 0.17
61 0.15
62 0.14
63 0.08
64 0.06
65 0.04
66 0.05
67 0.05
68 0.06
69 0.07
70 0.06
71 0.07
72 0.11
73 0.12
74 0.13
75 0.16
76 0.2
77 0.23
78 0.26
79 0.27
80 0.25
81 0.28
82 0.33
83 0.32
84 0.27
85 0.24
86 0.21
87 0.21
88 0.19
89 0.18
90 0.17
91 0.14
92 0.14
93 0.15
94 0.15
95 0.14
96 0.15
97 0.13
98 0.09
99 0.12
100 0.12
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.08
107 0.06
108 0.05