Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0T0T3

Protein Details
Accession G0T0T3   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
227-250ASMSEKSMGKRRARSNSRRRGEEWHydrophilic
NLS Segment(s)
PositionSequence
235-246GKRRARSNSRRR
Subcellular Location(s) nucl 9plas 9, mito 2, cyto 2, E.R. 2, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
PROSITE View protein in PROSITE  
PS01309  UPF0057  
Amino Acid Sequences MAYGTYLHRQVAAERDSQVNHVSSWMTVRDFASMNPLLQADLDFSRSQDRDLYQLCLVVLSVLLPPAAVFLQRGCGGDLLASCLLTFLGFLPGLVHALYITFKVRPAFSSPYPPSPDLTVSQYESAIVYNPEHYNHSTLEEASHAPLTTDDILRAASDEDRQEKERIRREKGGADASDVSSDEGVDKSRYSLARTPSYRSTATGPPAYDAHDPSDSEDDLARYHRYASMSEKSMGKRRARSNSRRRGEEWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.29
4 0.31
5 0.31
6 0.24
7 0.21
8 0.2
9 0.18
10 0.15
11 0.17
12 0.17
13 0.15
14 0.16
15 0.16
16 0.17
17 0.17
18 0.17
19 0.21
20 0.2
21 0.19
22 0.18
23 0.18
24 0.15
25 0.15
26 0.15
27 0.1
28 0.1
29 0.13
30 0.12
31 0.12
32 0.19
33 0.19
34 0.2
35 0.21
36 0.21
37 0.24
38 0.26
39 0.29
40 0.22
41 0.23
42 0.22
43 0.18
44 0.17
45 0.11
46 0.09
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.08
59 0.1
60 0.11
61 0.11
62 0.11
63 0.1
64 0.11
65 0.11
66 0.11
67 0.09
68 0.09
69 0.08
70 0.08
71 0.07
72 0.06
73 0.06
74 0.04
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.06
82 0.06
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.06
89 0.08
90 0.09
91 0.1
92 0.11
93 0.15
94 0.19
95 0.19
96 0.28
97 0.29
98 0.33
99 0.36
100 0.36
101 0.32
102 0.28
103 0.29
104 0.21
105 0.21
106 0.18
107 0.15
108 0.15
109 0.14
110 0.13
111 0.11
112 0.1
113 0.08
114 0.07
115 0.06
116 0.08
117 0.08
118 0.09
119 0.11
120 0.12
121 0.13
122 0.13
123 0.14
124 0.12
125 0.12
126 0.11
127 0.11
128 0.1
129 0.09
130 0.09
131 0.08
132 0.07
133 0.07
134 0.09
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.07
143 0.06
144 0.08
145 0.11
146 0.14
147 0.16
148 0.19
149 0.22
150 0.27
151 0.35
152 0.42
153 0.47
154 0.5
155 0.54
156 0.55
157 0.56
158 0.55
159 0.54
160 0.45
161 0.4
162 0.35
163 0.29
164 0.27
165 0.22
166 0.17
167 0.11
168 0.1
169 0.08
170 0.07
171 0.08
172 0.08
173 0.08
174 0.09
175 0.14
176 0.15
177 0.19
178 0.23
179 0.28
180 0.36
181 0.38
182 0.43
183 0.43
184 0.47
185 0.43
186 0.4
187 0.39
188 0.35
189 0.38
190 0.36
191 0.32
192 0.3
193 0.29
194 0.31
195 0.29
196 0.25
197 0.24
198 0.22
199 0.22
200 0.23
201 0.26
202 0.22
203 0.2
204 0.2
205 0.17
206 0.16
207 0.19
208 0.18
209 0.14
210 0.16
211 0.18
212 0.19
213 0.2
214 0.26
215 0.3
216 0.32
217 0.35
218 0.39
219 0.42
220 0.5
221 0.55
222 0.57
223 0.59
224 0.64
225 0.72
226 0.77
227 0.82
228 0.84
229 0.87
230 0.88
231 0.86