Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W6R9

Protein Details
Accession A0A2N5W6R9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-42LVNPRDSVPRKPGRKPTKFTQPKPQSSKQPLDPHydrophilic
NLS Segment(s)
PositionSequence
20-24KPGRK
Subcellular Location(s) mito 12.5, cyto_mito 9.999, cyto_nucl 7.833, nucl 6.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MSLCPEIQFLVNPRDSVPRKPGRKPTKFTQPKPQSSKQPLDPPPACSAASNTLEIDSTAFVHNGTDTDDKYEAWRYEYTPTLKDIYLDAEVKAPGDADTEAPGSVAGAAKKHFLPAPPKPLPTPTENCRSPVHGVDQLLQVGKAPPKSQRTVPHAYASTDFIPVTMLEFPPPIKLMIKPITPSTINLFPSLATNPFCPTFANSLNNLSTSSLPRLITHGVFNAQAIPRVTSSFSSRPNCRTVFFAIRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.41
4 0.47
5 0.5
6 0.55
7 0.64
8 0.73
9 0.74
10 0.81
11 0.82
12 0.81
13 0.82
14 0.85
15 0.83
16 0.83
17 0.83
18 0.83
19 0.85
20 0.84
21 0.83
22 0.81
23 0.82
24 0.79
25 0.78
26 0.73
27 0.74
28 0.68
29 0.62
30 0.57
31 0.52
32 0.44
33 0.35
34 0.32
35 0.29
36 0.28
37 0.25
38 0.21
39 0.19
40 0.19
41 0.18
42 0.16
43 0.09
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.11
52 0.11
53 0.11
54 0.14
55 0.15
56 0.15
57 0.17
58 0.22
59 0.19
60 0.2
61 0.21
62 0.19
63 0.22
64 0.27
65 0.28
66 0.24
67 0.25
68 0.24
69 0.23
70 0.22
71 0.19
72 0.16
73 0.16
74 0.16
75 0.14
76 0.13
77 0.13
78 0.13
79 0.12
80 0.1
81 0.07
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.09
97 0.09
98 0.1
99 0.11
100 0.13
101 0.19
102 0.24
103 0.33
104 0.34
105 0.35
106 0.35
107 0.37
108 0.36
109 0.34
110 0.34
111 0.29
112 0.35
113 0.34
114 0.36
115 0.34
116 0.34
117 0.3
118 0.27
119 0.26
120 0.21
121 0.21
122 0.2
123 0.2
124 0.18
125 0.16
126 0.14
127 0.11
128 0.1
129 0.12
130 0.11
131 0.12
132 0.18
133 0.22
134 0.25
135 0.3
136 0.36
137 0.41
138 0.47
139 0.48
140 0.47
141 0.43
142 0.42
143 0.38
144 0.33
145 0.26
146 0.2
147 0.18
148 0.12
149 0.12
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.09
156 0.09
157 0.1
158 0.1
159 0.1
160 0.1
161 0.11
162 0.17
163 0.21
164 0.23
165 0.24
166 0.24
167 0.27
168 0.27
169 0.27
170 0.26
171 0.27
172 0.25
173 0.24
174 0.23
175 0.19
176 0.2
177 0.21
178 0.18
179 0.14
180 0.14
181 0.17
182 0.17
183 0.17
184 0.17
185 0.18
186 0.21
187 0.24
188 0.27
189 0.26
190 0.29
191 0.29
192 0.29
193 0.26
194 0.23
195 0.2
196 0.2
197 0.21
198 0.21
199 0.21
200 0.21
201 0.23
202 0.25
203 0.25
204 0.23
205 0.22
206 0.21
207 0.2
208 0.2
209 0.22
210 0.19
211 0.22
212 0.21
213 0.21
214 0.2
215 0.21
216 0.23
217 0.2
218 0.26
219 0.29
220 0.36
221 0.42
222 0.47
223 0.5
224 0.56
225 0.55
226 0.5
227 0.48
228 0.47