Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5T6J3

Protein Details
Accession A0A2N5T6J3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
336-363GSQFNPPYPRNRRLRYRGGRSNPNSRTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPSHLRNGKDLSFEQRRAAERAAARDAGRIRQQQQLADLASRSSAPELPLLSAFHSYHELPNANGPASSIRQSSANNGLSAPSSAIDHPSVLGNQPAAGYTLSPAALEKIRRSREQQQVAGATSSINLSRAIELRPSSDLCATGLSDPASHRSAAGGYPPVGYSLSSDALEQLCRAQEPQSDAQKLGQDGPLNSQPSGSPRPREIHGHSHTSSGRVHDYLKHPSGPVVPVYQRSAERQHASYENSPSPSGLYPASPSKHVRDPLYDAGVRWMDSPTRAIHTSSDQAPPDPTTPPATGPLQGSQIQHPTAQEQHHVQLQPPLQSNHHHYAQHPRQNGSQFNPPYPRNRRLRYRGGRSNPNSRTAPLDQLPPNPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.5
4 0.49
5 0.48
6 0.45
7 0.41
8 0.45
9 0.45
10 0.42
11 0.39
12 0.4
13 0.41
14 0.4
15 0.44
16 0.45
17 0.43
18 0.47
19 0.49
20 0.46
21 0.46
22 0.44
23 0.38
24 0.33
25 0.31
26 0.23
27 0.21
28 0.19
29 0.17
30 0.14
31 0.14
32 0.13
33 0.15
34 0.16
35 0.17
36 0.18
37 0.18
38 0.17
39 0.19
40 0.18
41 0.17
42 0.19
43 0.19
44 0.2
45 0.24
46 0.23
47 0.2
48 0.26
49 0.26
50 0.23
51 0.22
52 0.2
53 0.19
54 0.21
55 0.22
56 0.17
57 0.16
58 0.19
59 0.2
60 0.24
61 0.29
62 0.28
63 0.26
64 0.25
65 0.25
66 0.23
67 0.23
68 0.18
69 0.1
70 0.09
71 0.09
72 0.12
73 0.11
74 0.11
75 0.11
76 0.11
77 0.12
78 0.11
79 0.12
80 0.1
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.07
87 0.07
88 0.08
89 0.08
90 0.07
91 0.07
92 0.08
93 0.12
94 0.14
95 0.19
96 0.26
97 0.31
98 0.34
99 0.4
100 0.48
101 0.55
102 0.6
103 0.57
104 0.54
105 0.52
106 0.49
107 0.43
108 0.33
109 0.23
110 0.16
111 0.14
112 0.09
113 0.08
114 0.07
115 0.07
116 0.08
117 0.1
118 0.11
119 0.13
120 0.13
121 0.14
122 0.16
123 0.16
124 0.16
125 0.15
126 0.15
127 0.12
128 0.12
129 0.11
130 0.1
131 0.1
132 0.09
133 0.09
134 0.09
135 0.12
136 0.12
137 0.12
138 0.11
139 0.1
140 0.11
141 0.1
142 0.12
143 0.1
144 0.09
145 0.1
146 0.1
147 0.1
148 0.09
149 0.09
150 0.08
151 0.08
152 0.09
153 0.09
154 0.08
155 0.09
156 0.09
157 0.09
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.09
165 0.14
166 0.2
167 0.24
168 0.25
169 0.25
170 0.26
171 0.26
172 0.25
173 0.22
174 0.18
175 0.14
176 0.13
177 0.16
178 0.18
179 0.18
180 0.17
181 0.16
182 0.14
183 0.18
184 0.24
185 0.24
186 0.22
187 0.24
188 0.27
189 0.29
190 0.34
191 0.34
192 0.37
193 0.38
194 0.42
195 0.39
196 0.41
197 0.39
198 0.36
199 0.32
200 0.24
201 0.22
202 0.17
203 0.18
204 0.19
205 0.22
206 0.27
207 0.28
208 0.27
209 0.26
210 0.26
211 0.27
212 0.23
213 0.2
214 0.17
215 0.16
216 0.18
217 0.19
218 0.21
219 0.2
220 0.22
221 0.26
222 0.28
223 0.29
224 0.28
225 0.3
226 0.3
227 0.33
228 0.34
229 0.34
230 0.31
231 0.3
232 0.29
233 0.26
234 0.24
235 0.2
236 0.18
237 0.13
238 0.11
239 0.12
240 0.17
241 0.19
242 0.21
243 0.23
244 0.26
245 0.32
246 0.35
247 0.35
248 0.34
249 0.38
250 0.38
251 0.41
252 0.37
253 0.31
254 0.31
255 0.3
256 0.26
257 0.21
258 0.18
259 0.14
260 0.14
261 0.16
262 0.14
263 0.17
264 0.18
265 0.18
266 0.19
267 0.22
268 0.25
269 0.26
270 0.29
271 0.25
272 0.25
273 0.26
274 0.27
275 0.25
276 0.22
277 0.21
278 0.2
279 0.21
280 0.21
281 0.23
282 0.22
283 0.23
284 0.24
285 0.24
286 0.23
287 0.26
288 0.26
289 0.26
290 0.28
291 0.27
292 0.26
293 0.25
294 0.25
295 0.26
296 0.26
297 0.27
298 0.26
299 0.28
300 0.33
301 0.33
302 0.31
303 0.32
304 0.34
305 0.35
306 0.37
307 0.37
308 0.33
309 0.38
310 0.44
311 0.44
312 0.46
313 0.42
314 0.4
315 0.48
316 0.56
317 0.59
318 0.56
319 0.53
320 0.54
321 0.59
322 0.63
323 0.56
324 0.56
325 0.52
326 0.54
327 0.58
328 0.56
329 0.6
330 0.63
331 0.67
332 0.68
333 0.73
334 0.77
335 0.78
336 0.85
337 0.85
338 0.87
339 0.88
340 0.88
341 0.89
342 0.86
343 0.88
344 0.81
345 0.77
346 0.7
347 0.6
348 0.58
349 0.51
350 0.52
351 0.44
352 0.48
353 0.44