Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5TAC2

Protein Details
Accession A0A2N5TAC2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MNQLAKKKPRTRDRVRWHCTVRPKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MNQLAKKKPRTRDRVRWHCTVRPKPVPAGQTGLPNQFPADGDRSHPGTYRTGQSDRLAQASVGPCWSDHRSNTAVVALLNQPCSTSQCRQCERKPLFFPNSHVCIETPMLSRTISHRVQHTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.87
4 0.83
5 0.8
6 0.8
7 0.78
8 0.77
9 0.74
10 0.72
11 0.68
12 0.66
13 0.61
14 0.53
15 0.48
16 0.39
17 0.37
18 0.37
19 0.34
20 0.29
21 0.27
22 0.24
23 0.2
24 0.19
25 0.15
26 0.15
27 0.13
28 0.14
29 0.17
30 0.2
31 0.2
32 0.21
33 0.2
34 0.2
35 0.22
36 0.23
37 0.24
38 0.23
39 0.25
40 0.25
41 0.27
42 0.25
43 0.24
44 0.2
45 0.16
46 0.17
47 0.16
48 0.15
49 0.1
50 0.1
51 0.09
52 0.12
53 0.15
54 0.15
55 0.14
56 0.18
57 0.2
58 0.2
59 0.2
60 0.17
61 0.15
62 0.12
63 0.13
64 0.12
65 0.11
66 0.12
67 0.11
68 0.11
69 0.11
70 0.15
71 0.18
72 0.22
73 0.29
74 0.37
75 0.45
76 0.52
77 0.56
78 0.64
79 0.66
80 0.68
81 0.67
82 0.67
83 0.68
84 0.64
85 0.65
86 0.62
87 0.6
88 0.51
89 0.46
90 0.37
91 0.33
92 0.31
93 0.29
94 0.23
95 0.2
96 0.2
97 0.19
98 0.2
99 0.21
100 0.28
101 0.29
102 0.3