Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VUI2

Protein Details
Accession A0A2N5VUI2    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
166-191EAPFVHQRRERREPRERQKWPEHKLEBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10.5, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004087  KH_dom  
IPR036612  KH_dom_type_1_sf  
IPR031121  RIK/BLOM7  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
CDD cd22385  KH-I_KHDC4_rpt1  
cd22386  KH-I_KHDC4_rpt2  
Amino Acid Sequences MSDRKRKWDSGPDGSPSTKAKHDASPATNPTETTPDTNGAADAAAAIAARIAAQYAPPPPKVKSSEPPKYEKDKPEVNDPEFVKDIDINDQRNRYLLTKGPTQAEIQAETGCSVTTKGQWYPDRTKALDRDPPLYLHLTATSQEILDKGIAKVNELIEQDLGPLTEAPFVHQRRERREPRERQKWPEHKLEIGLENLRNFNVRAKVVGPGGMFVKYIQSETGSRVQIKGVGSGFYENDTGAESTEPMHINITGPDDTQNIKAKELAEDLLETVKEKWAEAKAVNDQAQAQYNTPMVNQPMYMGFGGVPGQGQVPGMMGQMPPQYGQPPLPTTGDAPPPPSSDAPPLPTGDAPAPPGGQPGAATPAGTAPGATGQDYSAYYAQYYAQQAQTMTAEQRAYYNSPEYIAWYQQYLQYQQQAQATGGVNPIAALQQQQQQQPSSMLATPSQPPLPSSAPPPPNQPPAPPPPSEDVAPPPPPEPAPEPPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.51
4 0.46
5 0.4
6 0.39
7 0.37
8 0.38
9 0.45
10 0.49
11 0.51
12 0.56
13 0.55
14 0.56
15 0.53
16 0.47
17 0.42
18 0.4
19 0.36
20 0.31
21 0.29
22 0.26
23 0.27
24 0.26
25 0.24
26 0.18
27 0.16
28 0.12
29 0.09
30 0.06
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.09
42 0.16
43 0.21
44 0.25
45 0.28
46 0.3
47 0.38
48 0.43
49 0.47
50 0.5
51 0.56
52 0.62
53 0.65
54 0.7
55 0.7
56 0.72
57 0.74
58 0.71
59 0.68
60 0.66
61 0.63
62 0.67
63 0.68
64 0.62
65 0.61
66 0.54
67 0.51
68 0.44
69 0.41
70 0.32
71 0.25
72 0.24
73 0.25
74 0.29
75 0.29
76 0.33
77 0.35
78 0.34
79 0.34
80 0.35
81 0.29
82 0.28
83 0.29
84 0.28
85 0.33
86 0.36
87 0.36
88 0.35
89 0.35
90 0.35
91 0.31
92 0.28
93 0.22
94 0.19
95 0.17
96 0.16
97 0.15
98 0.1
99 0.09
100 0.08
101 0.08
102 0.11
103 0.15
104 0.16
105 0.24
106 0.3
107 0.37
108 0.43
109 0.49
110 0.51
111 0.5
112 0.54
113 0.52
114 0.53
115 0.53
116 0.48
117 0.44
118 0.4
119 0.39
120 0.35
121 0.32
122 0.26
123 0.2
124 0.18
125 0.15
126 0.14
127 0.14
128 0.12
129 0.1
130 0.1
131 0.09
132 0.09
133 0.09
134 0.1
135 0.09
136 0.12
137 0.12
138 0.12
139 0.15
140 0.15
141 0.18
142 0.17
143 0.17
144 0.14
145 0.14
146 0.13
147 0.11
148 0.1
149 0.06
150 0.06
151 0.06
152 0.08
153 0.08
154 0.1
155 0.18
156 0.19
157 0.25
158 0.29
159 0.35
160 0.41
161 0.52
162 0.58
163 0.6
164 0.69
165 0.74
166 0.8
167 0.85
168 0.84
169 0.83
170 0.85
171 0.85
172 0.8
173 0.79
174 0.7
175 0.61
176 0.56
177 0.49
178 0.4
179 0.33
180 0.3
181 0.22
182 0.21
183 0.2
184 0.18
185 0.16
186 0.15
187 0.16
188 0.16
189 0.15
190 0.15
191 0.15
192 0.17
193 0.17
194 0.19
195 0.14
196 0.12
197 0.13
198 0.12
199 0.11
200 0.09
201 0.1
202 0.08
203 0.08
204 0.07
205 0.08
206 0.09
207 0.12
208 0.17
209 0.17
210 0.17
211 0.17
212 0.17
213 0.19
214 0.18
215 0.18
216 0.13
217 0.12
218 0.12
219 0.12
220 0.12
221 0.1
222 0.1
223 0.07
224 0.06
225 0.07
226 0.07
227 0.06
228 0.06
229 0.05
230 0.06
231 0.08
232 0.08
233 0.08
234 0.08
235 0.08
236 0.08
237 0.09
238 0.11
239 0.08
240 0.08
241 0.09
242 0.1
243 0.11
244 0.14
245 0.2
246 0.18
247 0.18
248 0.2
249 0.19
250 0.19
251 0.19
252 0.16
253 0.1
254 0.1
255 0.1
256 0.09
257 0.08
258 0.08
259 0.07
260 0.09
261 0.08
262 0.08
263 0.11
264 0.12
265 0.14
266 0.14
267 0.17
268 0.18
269 0.23
270 0.24
271 0.21
272 0.2
273 0.19
274 0.23
275 0.21
276 0.17
277 0.14
278 0.14
279 0.14
280 0.14
281 0.14
282 0.11
283 0.11
284 0.1
285 0.09
286 0.09
287 0.1
288 0.1
289 0.08
290 0.07
291 0.07
292 0.07
293 0.07
294 0.06
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.05
301 0.05
302 0.06
303 0.06
304 0.06
305 0.08
306 0.09
307 0.09
308 0.09
309 0.1
310 0.11
311 0.11
312 0.13
313 0.14
314 0.15
315 0.17
316 0.17
317 0.17
318 0.19
319 0.21
320 0.25
321 0.22
322 0.24
323 0.23
324 0.24
325 0.26
326 0.25
327 0.23
328 0.23
329 0.25
330 0.25
331 0.25
332 0.24
333 0.23
334 0.22
335 0.21
336 0.17
337 0.16
338 0.15
339 0.14
340 0.14
341 0.12
342 0.13
343 0.11
344 0.1
345 0.09
346 0.09
347 0.11
348 0.11
349 0.11
350 0.1
351 0.1
352 0.11
353 0.11
354 0.09
355 0.06
356 0.08
357 0.09
358 0.09
359 0.09
360 0.08
361 0.1
362 0.1
363 0.12
364 0.11
365 0.11
366 0.1
367 0.11
368 0.12
369 0.14
370 0.16
371 0.17
372 0.17
373 0.18
374 0.19
375 0.19
376 0.2
377 0.18
378 0.17
379 0.17
380 0.16
381 0.15
382 0.16
383 0.18
384 0.19
385 0.2
386 0.21
387 0.18
388 0.2
389 0.19
390 0.22
391 0.22
392 0.22
393 0.2
394 0.19
395 0.2
396 0.22
397 0.26
398 0.24
399 0.26
400 0.29
401 0.3
402 0.33
403 0.35
404 0.32
405 0.29
406 0.31
407 0.28
408 0.23
409 0.22
410 0.18
411 0.15
412 0.13
413 0.13
414 0.09
415 0.08
416 0.09
417 0.11
418 0.17
419 0.23
420 0.27
421 0.3
422 0.31
423 0.33
424 0.33
425 0.31
426 0.28
427 0.25
428 0.23
429 0.21
430 0.22
431 0.23
432 0.26
433 0.27
434 0.24
435 0.23
436 0.26
437 0.28
438 0.27
439 0.3
440 0.36
441 0.39
442 0.41
443 0.49
444 0.5
445 0.56
446 0.56
447 0.56
448 0.54
449 0.58
450 0.61
451 0.55
452 0.53
453 0.49
454 0.51
455 0.46
456 0.42
457 0.39
458 0.41
459 0.44
460 0.41
461 0.36
462 0.36
463 0.35
464 0.37
465 0.36
466 0.36