Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SDR0

Protein Details
Accession A0A2N5SDR0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
56-77RLQAKIKDRKAAKRKTAEGETKBasic
NLS Segment(s)
PositionSequence
60-70KIKDRKAAKRK
Subcellular Location(s) extr 13, plas 5, nucl 3, mito 2, cyto 2, pero 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTSQAEDAHHTVSVSSFGVFGILAGILAGGILLAYVLTSFKGWLAATHGGDDAGRLQAKIKDRKAAKRKTAEGETKDLEAGITTISEKPWTHHKRLSLASIRTPTTTLHRRSQEYYDQQRRQKGSDLKASISRPKRLLPSAVTYVIVRSPLHSAGSHHHLAITSPRASRAHSLHSPRLHLVPRNMGRPQPPRLADGTPAAEPPSDVPPVNAPFANQPHTGRRVVWFDELASPLPSRTSRTNSLPSSWHEVLPSSAADATDEGPGLARRPLKPSAHLPSCRTSAVQRERNAPSRTREKRRTELLVLAAVPESRHAVTLFIRWDQQPAHAHCTLSYPCAETLRHATRGRVSLGHCRRWLPDIPVSLRKPTGPRPKHAGHHNEPTRDTVLYRVLAHRSSTCAKSAMQKTHTCSPCPSPSFSASSRDDQDPTTKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.11
4 0.09
5 0.08
6 0.09
7 0.08
8 0.07
9 0.06
10 0.05
11 0.05
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.04
26 0.04
27 0.05
28 0.06
29 0.08
30 0.08
31 0.09
32 0.14
33 0.19
34 0.19
35 0.21
36 0.2
37 0.19
38 0.18
39 0.18
40 0.14
41 0.13
42 0.13
43 0.12
44 0.15
45 0.2
46 0.29
47 0.38
48 0.41
49 0.45
50 0.52
51 0.63
52 0.71
53 0.76
54 0.77
55 0.77
56 0.8
57 0.79
58 0.81
59 0.79
60 0.73
61 0.7
62 0.62
63 0.54
64 0.46
65 0.38
66 0.28
67 0.19
68 0.15
69 0.08
70 0.06
71 0.07
72 0.08
73 0.08
74 0.12
75 0.12
76 0.14
77 0.25
78 0.32
79 0.37
80 0.41
81 0.45
82 0.48
83 0.52
84 0.59
85 0.56
86 0.52
87 0.52
88 0.52
89 0.48
90 0.42
91 0.4
92 0.32
93 0.32
94 0.37
95 0.36
96 0.4
97 0.45
98 0.48
99 0.51
100 0.55
101 0.56
102 0.57
103 0.62
104 0.65
105 0.67
106 0.69
107 0.73
108 0.7
109 0.63
110 0.62
111 0.59
112 0.56
113 0.57
114 0.54
115 0.49
116 0.51
117 0.52
118 0.52
119 0.5
120 0.49
121 0.42
122 0.43
123 0.46
124 0.43
125 0.44
126 0.39
127 0.38
128 0.37
129 0.35
130 0.32
131 0.27
132 0.24
133 0.21
134 0.19
135 0.13
136 0.1
137 0.12
138 0.12
139 0.13
140 0.13
141 0.14
142 0.16
143 0.22
144 0.21
145 0.19
146 0.19
147 0.17
148 0.17
149 0.2
150 0.2
151 0.17
152 0.17
153 0.2
154 0.2
155 0.21
156 0.26
157 0.24
158 0.27
159 0.3
160 0.36
161 0.39
162 0.41
163 0.41
164 0.38
165 0.4
166 0.37
167 0.34
168 0.31
169 0.34
170 0.34
171 0.37
172 0.37
173 0.35
174 0.39
175 0.41
176 0.44
177 0.41
178 0.39
179 0.37
180 0.38
181 0.36
182 0.31
183 0.28
184 0.24
185 0.18
186 0.17
187 0.15
188 0.12
189 0.11
190 0.11
191 0.11
192 0.1
193 0.1
194 0.1
195 0.13
196 0.15
197 0.16
198 0.14
199 0.12
200 0.14
201 0.16
202 0.2
203 0.18
204 0.18
205 0.21
206 0.25
207 0.25
208 0.22
209 0.23
210 0.23
211 0.23
212 0.22
213 0.19
214 0.16
215 0.17
216 0.17
217 0.15
218 0.13
219 0.11
220 0.1
221 0.11
222 0.11
223 0.12
224 0.15
225 0.19
226 0.23
227 0.27
228 0.34
229 0.34
230 0.36
231 0.35
232 0.34
233 0.38
234 0.34
235 0.3
236 0.23
237 0.22
238 0.2
239 0.19
240 0.16
241 0.08
242 0.08
243 0.07
244 0.07
245 0.07
246 0.07
247 0.07
248 0.07
249 0.06
250 0.06
251 0.07
252 0.07
253 0.1
254 0.13
255 0.14
256 0.19
257 0.25
258 0.26
259 0.3
260 0.36
261 0.42
262 0.46
263 0.49
264 0.48
265 0.46
266 0.46
267 0.43
268 0.37
269 0.31
270 0.33
271 0.38
272 0.42
273 0.41
274 0.46
275 0.51
276 0.58
277 0.6
278 0.54
279 0.52
280 0.55
281 0.62
282 0.65
283 0.7
284 0.69
285 0.73
286 0.75
287 0.74
288 0.67
289 0.62
290 0.53
291 0.46
292 0.38
293 0.31
294 0.24
295 0.18
296 0.14
297 0.11
298 0.1
299 0.08
300 0.09
301 0.09
302 0.1
303 0.11
304 0.15
305 0.17
306 0.16
307 0.19
308 0.18
309 0.21
310 0.2
311 0.25
312 0.29
313 0.31
314 0.36
315 0.35
316 0.35
317 0.32
318 0.37
319 0.32
320 0.26
321 0.23
322 0.19
323 0.18
324 0.21
325 0.21
326 0.18
327 0.26
328 0.29
329 0.36
330 0.35
331 0.37
332 0.39
333 0.43
334 0.42
335 0.38
336 0.36
337 0.39
338 0.46
339 0.51
340 0.48
341 0.47
342 0.47
343 0.47
344 0.49
345 0.44
346 0.42
347 0.42
348 0.45
349 0.52
350 0.52
351 0.52
352 0.48
353 0.46
354 0.46
355 0.48
356 0.54
357 0.51
358 0.55
359 0.6
360 0.65
361 0.69
362 0.73
363 0.73
364 0.69
365 0.74
366 0.75
367 0.72
368 0.66
369 0.63
370 0.55
371 0.46
372 0.39
373 0.32
374 0.29
375 0.27
376 0.28
377 0.28
378 0.29
379 0.3
380 0.33
381 0.3
382 0.31
383 0.34
384 0.34
385 0.32
386 0.3
387 0.3
388 0.37
389 0.44
390 0.47
391 0.49
392 0.52
393 0.56
394 0.64
395 0.66
396 0.6
397 0.56
398 0.55
399 0.58
400 0.56
401 0.55
402 0.5
403 0.5
404 0.53
405 0.5
406 0.5
407 0.45
408 0.47
409 0.47
410 0.45
411 0.43
412 0.39