Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TRQ0

Protein Details
Accession A0A2N5TRQ0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
168-193ALIQKERTKIKQKKEQQKSNRVENVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF05198  IF3_N  
Amino Acid Sequences MMVAYRPTISHPSPRYLRVLLGPTCDHGVKRVDLFRNKHLPNRQIHHETMLLRTNARPSGFSLDCRLTDNPFVESSRKTFSFEAPKQKMKAASDHQIRSEWIQLVNPTSTLGEKPTTRENNTSANSSILIEPALTRDVLSRIDLNQYTLIEVNSKANPPICKIVSREALIQKERTKIKQKKEQQKSNRVENVIKEIQLTWKIDTNDLNHKLKTVQHCFEKSYKVRVIINSSRYQQTDQRHKDELLTVIEEQLTGFGGELVKQETEGGKLIMEWHPINKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.47
4 0.46
5 0.42
6 0.45
7 0.39
8 0.39
9 0.36
10 0.33
11 0.34
12 0.33
13 0.27
14 0.24
15 0.26
16 0.24
17 0.28
18 0.34
19 0.39
20 0.46
21 0.51
22 0.56
23 0.62
24 0.62
25 0.66
26 0.67
27 0.66
28 0.66
29 0.67
30 0.67
31 0.63
32 0.61
33 0.57
34 0.52
35 0.46
36 0.41
37 0.41
38 0.33
39 0.28
40 0.28
41 0.29
42 0.28
43 0.28
44 0.24
45 0.21
46 0.28
47 0.28
48 0.28
49 0.29
50 0.28
51 0.28
52 0.31
53 0.29
54 0.24
55 0.26
56 0.26
57 0.23
58 0.22
59 0.23
60 0.21
61 0.22
62 0.22
63 0.24
64 0.24
65 0.25
66 0.25
67 0.29
68 0.37
69 0.41
70 0.49
71 0.5
72 0.55
73 0.53
74 0.55
75 0.54
76 0.45
77 0.47
78 0.41
79 0.44
80 0.46
81 0.47
82 0.44
83 0.41
84 0.4
85 0.34
86 0.32
87 0.24
88 0.17
89 0.17
90 0.16
91 0.17
92 0.16
93 0.15
94 0.11
95 0.1
96 0.1
97 0.09
98 0.1
99 0.11
100 0.11
101 0.14
102 0.22
103 0.26
104 0.28
105 0.3
106 0.31
107 0.35
108 0.36
109 0.36
110 0.28
111 0.24
112 0.21
113 0.19
114 0.17
115 0.1
116 0.09
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.06
124 0.07
125 0.07
126 0.08
127 0.08
128 0.08
129 0.12
130 0.12
131 0.12
132 0.12
133 0.11
134 0.11
135 0.11
136 0.1
137 0.08
138 0.09
139 0.1
140 0.1
141 0.11
142 0.11
143 0.13
144 0.14
145 0.15
146 0.2
147 0.19
148 0.2
149 0.22
150 0.27
151 0.28
152 0.28
153 0.31
154 0.3
155 0.34
156 0.33
157 0.35
158 0.33
159 0.36
160 0.38
161 0.4
162 0.47
163 0.5
164 0.57
165 0.63
166 0.71
167 0.75
168 0.82
169 0.86
170 0.85
171 0.88
172 0.85
173 0.85
174 0.8
175 0.73
176 0.65
177 0.57
178 0.54
179 0.45
180 0.39
181 0.3
182 0.24
183 0.25
184 0.26
185 0.25
186 0.19
187 0.22
188 0.22
189 0.24
190 0.26
191 0.26
192 0.32
193 0.37
194 0.39
195 0.34
196 0.34
197 0.34
198 0.36
199 0.42
200 0.4
201 0.4
202 0.44
203 0.47
204 0.5
205 0.52
206 0.56
207 0.5
208 0.51
209 0.49
210 0.45
211 0.46
212 0.46
213 0.5
214 0.48
215 0.51
216 0.48
217 0.47
218 0.48
219 0.46
220 0.46
221 0.44
222 0.46
223 0.52
224 0.54
225 0.56
226 0.56
227 0.55
228 0.54
229 0.51
230 0.45
231 0.37
232 0.32
233 0.27
234 0.24
235 0.23
236 0.2
237 0.16
238 0.12
239 0.09
240 0.06
241 0.06
242 0.06
243 0.06
244 0.08
245 0.09
246 0.11
247 0.11
248 0.11
249 0.13
250 0.12
251 0.14
252 0.15
253 0.14
254 0.12
255 0.12
256 0.16
257 0.17
258 0.21
259 0.2
260 0.23