Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SV38

Protein Details
Accession A0A2N5SV38   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-89IDGYHAPKPRQAKRHRVRSLBasic
NLS Segment(s)
PositionSequence
78-85PRQAKRHR
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MARCPAGKLAASGRMGRKSSPSFRGSLRKTPSARAWSLTGPRTEGMDHARTRHTFRISVYAVRDLYRASIDGYHAPKPRQAKRHRVRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.36
4 0.39
5 0.4
6 0.44
7 0.46
8 0.44
9 0.4
10 0.44
11 0.53
12 0.51
13 0.53
14 0.51
15 0.52
16 0.52
17 0.54
18 0.55
19 0.51
20 0.47
21 0.41
22 0.38
23 0.33
24 0.36
25 0.34
26 0.27
27 0.22
28 0.22
29 0.2
30 0.18
31 0.16
32 0.15
33 0.18
34 0.18
35 0.18
36 0.22
37 0.22
38 0.26
39 0.3
40 0.29
41 0.25
42 0.26
43 0.31
44 0.3
45 0.32
46 0.3
47 0.29
48 0.27
49 0.26
50 0.25
51 0.18
52 0.17
53 0.15
54 0.13
55 0.1
56 0.1
57 0.12
58 0.18
59 0.21
60 0.26
61 0.31
62 0.31
63 0.35
64 0.43
65 0.5
66 0.55
67 0.61
68 0.66
69 0.72