Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U4R4

Protein Details
Accession A0A2N5U4R4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
201-228AETNPANLSKRQRKKMRKLERARLAAATHydrophilic
NLS Segment(s)
PositionSequence
210-223KRQRKKMRKLERAR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MLMELPVNSMLSTKPADPKQDGQELDLQDFQAKLETSLGNIQAMVESWLPKELQTIHQPASDQSKRAFELNSSRPRNSKLGLGSVAPKHTQSQLSTSKLHSQLTKKPKKDGEAEAGEFPRPSLDRQTESEENDEDSRTTCTFGKKRSAPNPGSSSFDLLQPPTKVHKPSSSANTSQNAPMKTQPAPADSLLQTSQLPANAAETNPANLSKRQRKKMRKLERARLAAATTPAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.33
4 0.37
5 0.43
6 0.47
7 0.52
8 0.5
9 0.44
10 0.46
11 0.42
12 0.39
13 0.34
14 0.28
15 0.22
16 0.21
17 0.19
18 0.16
19 0.14
20 0.13
21 0.14
22 0.14
23 0.14
24 0.18
25 0.19
26 0.15
27 0.15
28 0.14
29 0.11
30 0.11
31 0.11
32 0.09
33 0.09
34 0.09
35 0.11
36 0.11
37 0.11
38 0.13
39 0.14
40 0.18
41 0.24
42 0.27
43 0.27
44 0.29
45 0.3
46 0.29
47 0.36
48 0.33
49 0.29
50 0.27
51 0.29
52 0.29
53 0.3
54 0.29
55 0.22
56 0.28
57 0.35
58 0.43
59 0.44
60 0.45
61 0.46
62 0.49
63 0.49
64 0.42
65 0.38
66 0.3
67 0.29
68 0.28
69 0.26
70 0.26
71 0.25
72 0.25
73 0.21
74 0.2
75 0.17
76 0.19
77 0.2
78 0.17
79 0.22
80 0.25
81 0.28
82 0.29
83 0.29
84 0.33
85 0.33
86 0.33
87 0.31
88 0.3
89 0.35
90 0.45
91 0.52
92 0.48
93 0.52
94 0.54
95 0.54
96 0.55
97 0.51
98 0.47
99 0.42
100 0.41
101 0.37
102 0.34
103 0.3
104 0.24
105 0.2
106 0.14
107 0.1
108 0.1
109 0.13
110 0.15
111 0.17
112 0.2
113 0.27
114 0.28
115 0.29
116 0.29
117 0.25
118 0.24
119 0.22
120 0.2
121 0.13
122 0.12
123 0.12
124 0.11
125 0.12
126 0.12
127 0.19
128 0.23
129 0.27
130 0.35
131 0.38
132 0.47
133 0.53
134 0.6
135 0.56
136 0.59
137 0.6
138 0.53
139 0.52
140 0.44
141 0.4
142 0.32
143 0.31
144 0.25
145 0.21
146 0.23
147 0.19
148 0.2
149 0.22
150 0.26
151 0.27
152 0.29
153 0.33
154 0.34
155 0.4
156 0.46
157 0.46
158 0.45
159 0.47
160 0.46
161 0.42
162 0.43
163 0.42
164 0.35
165 0.32
166 0.31
167 0.3
168 0.28
169 0.32
170 0.29
171 0.25
172 0.27
173 0.26
174 0.28
175 0.24
176 0.26
177 0.22
178 0.21
179 0.18
180 0.17
181 0.18
182 0.14
183 0.14
184 0.11
185 0.14
186 0.14
187 0.14
188 0.16
189 0.15
190 0.16
191 0.16
192 0.19
193 0.19
194 0.23
195 0.33
196 0.41
197 0.5
198 0.59
199 0.69
200 0.78
201 0.86
202 0.92
203 0.93
204 0.93
205 0.94
206 0.94
207 0.94
208 0.89
209 0.81
210 0.73
211 0.64
212 0.57