Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5VDA1

Protein Details
Accession A0A2N5VDA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
19-38LPKGVRTPPRTPKKKACGGCHydrophilic
NLS Segment(s)
PositionSequence
27-32PRTPKK
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MIVCWKVWSEPKRGLIAALPKGVRTPPRTPKKKACGGCTPSHTGVQTPARPPLHAARRPHAYKWREDGWLGVRPRRTGLLAMHACLEGVQALHALRTGVHGWHACPARLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.42
4 0.39
5 0.37
6 0.32
7 0.29
8 0.3
9 0.33
10 0.34
11 0.32
12 0.37
13 0.43
14 0.54
15 0.61
16 0.68
17 0.75
18 0.77
19 0.8
20 0.77
21 0.73
22 0.72
23 0.7
24 0.68
25 0.62
26 0.58
27 0.51
28 0.47
29 0.4
30 0.3
31 0.3
32 0.29
33 0.28
34 0.24
35 0.29
36 0.27
37 0.27
38 0.29
39 0.31
40 0.35
41 0.37
42 0.39
43 0.37
44 0.44
45 0.46
46 0.49
47 0.5
48 0.44
49 0.43
50 0.45
51 0.44
52 0.37
53 0.35
54 0.34
55 0.29
56 0.33
57 0.31
58 0.3
59 0.29
60 0.28
61 0.29
62 0.28
63 0.25
64 0.21
65 0.2
66 0.27
67 0.25
68 0.25
69 0.25
70 0.23
71 0.21
72 0.18
73 0.17
74 0.07
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.06
83 0.09
84 0.11
85 0.1
86 0.15
87 0.16
88 0.16
89 0.24
90 0.27