Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5URT0

Protein Details
Accession A0A2N5URT0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
232-254KAGTSSRKPKKIPKSTPLKVYRSHydrophilic
NLS Segment(s)
PositionSequence
238-244RKPKKIP
Subcellular Location(s) E.R. 9, golg 6, plas 5, mito 2, extr 2, nucl 1, pero 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009598  BC10  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06726  BC10  
Amino Acid Sequences MYCLRYFLLVLLFFPFPTAPPFLVFLFLISLTVEHRPCAYCSLLLSAILLSTCSWNISSVDVSPVYSDEYVHESTGSFLSSILSFFKSNEQLTGPTQPKNHTGFKIIKQENHDKPEPINRCWCYSNRGRLFEPVSSKKKELENLDLPEGYQPLSQSQAASSPSQILKTSTNDEGTNEDSKLDHTSLRKPSRQLKSIFSPLWKPLTKLSSARSPLTGPHLSAKSPSSPESTIKAGTSSRKPKKIPKSTPLKVYRSSFSRTPLIYSHVIQPLIQSITPKLPLPVIRRIILIINYNFLEVREKLVELRWIQDASNFFNSFKFPFLRTRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.15
5 0.17
6 0.14
7 0.16
8 0.19
9 0.18
10 0.2
11 0.19
12 0.16
13 0.14
14 0.13
15 0.12
16 0.09
17 0.09
18 0.09
19 0.15
20 0.15
21 0.14
22 0.16
23 0.18
24 0.19
25 0.22
26 0.22
27 0.18
28 0.19
29 0.22
30 0.2
31 0.19
32 0.18
33 0.14
34 0.12
35 0.11
36 0.1
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.1
43 0.1
44 0.12
45 0.12
46 0.11
47 0.14
48 0.14
49 0.13
50 0.12
51 0.12
52 0.13
53 0.12
54 0.11
55 0.1
56 0.14
57 0.15
58 0.15
59 0.14
60 0.12
61 0.13
62 0.13
63 0.12
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.1
71 0.1
72 0.11
73 0.15
74 0.18
75 0.18
76 0.2
77 0.19
78 0.2
79 0.22
80 0.29
81 0.27
82 0.27
83 0.3
84 0.31
85 0.36
86 0.38
87 0.41
88 0.35
89 0.38
90 0.4
91 0.44
92 0.52
93 0.49
94 0.47
95 0.49
96 0.57
97 0.57
98 0.58
99 0.54
100 0.45
101 0.44
102 0.5
103 0.48
104 0.42
105 0.44
106 0.39
107 0.4
108 0.42
109 0.41
110 0.38
111 0.41
112 0.48
113 0.45
114 0.47
115 0.45
116 0.46
117 0.47
118 0.44
119 0.44
120 0.42
121 0.42
122 0.41
123 0.41
124 0.4
125 0.41
126 0.42
127 0.38
128 0.38
129 0.38
130 0.38
131 0.38
132 0.34
133 0.31
134 0.27
135 0.23
136 0.16
137 0.1
138 0.08
139 0.07
140 0.09
141 0.09
142 0.08
143 0.08
144 0.1
145 0.11
146 0.11
147 0.11
148 0.12
149 0.12
150 0.13
151 0.13
152 0.12
153 0.13
154 0.14
155 0.17
156 0.16
157 0.17
158 0.17
159 0.17
160 0.17
161 0.18
162 0.17
163 0.14
164 0.13
165 0.12
166 0.12
167 0.14
168 0.12
169 0.12
170 0.13
171 0.2
172 0.29
173 0.35
174 0.38
175 0.41
176 0.49
177 0.54
178 0.58
179 0.55
180 0.51
181 0.51
182 0.55
183 0.52
184 0.45
185 0.4
186 0.36
187 0.4
188 0.35
189 0.3
190 0.28
191 0.29
192 0.3
193 0.29
194 0.3
195 0.31
196 0.34
197 0.34
198 0.3
199 0.28
200 0.27
201 0.31
202 0.28
203 0.21
204 0.23
205 0.24
206 0.22
207 0.24
208 0.24
209 0.21
210 0.22
211 0.23
212 0.21
213 0.22
214 0.24
215 0.26
216 0.26
217 0.23
218 0.21
219 0.22
220 0.2
221 0.24
222 0.31
223 0.39
224 0.45
225 0.52
226 0.57
227 0.65
228 0.73
229 0.79
230 0.79
231 0.78
232 0.8
233 0.78
234 0.84
235 0.83
236 0.77
237 0.72
238 0.66
239 0.62
240 0.56
241 0.55
242 0.48
243 0.43
244 0.44
245 0.38
246 0.37
247 0.33
248 0.34
249 0.31
250 0.3
251 0.32
252 0.3
253 0.3
254 0.27
255 0.26
256 0.24
257 0.24
258 0.22
259 0.18
260 0.16
261 0.19
262 0.21
263 0.21
264 0.19
265 0.21
266 0.27
267 0.3
268 0.37
269 0.38
270 0.37
271 0.37
272 0.37
273 0.36
274 0.33
275 0.35
276 0.27
277 0.26
278 0.25
279 0.25
280 0.24
281 0.21
282 0.23
283 0.16
284 0.2
285 0.18
286 0.19
287 0.2
288 0.23
289 0.29
290 0.25
291 0.28
292 0.27
293 0.26
294 0.25
295 0.28
296 0.28
297 0.27
298 0.34
299 0.32
300 0.29
301 0.29
302 0.32
303 0.29
304 0.31
305 0.28
306 0.23
307 0.3