Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W0D4

Protein Details
Accession A0A2N5W0D4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-128KEADSSKKSERKKKKAEAKKQASASHydrophilic
NLS Segment(s)
PositionSequence
103-133PKEADSSKKSERKKKKAEAKKQASASKERRQ
183-258KRADAPDPKSAPKAPTKPGSPPKEPSPLEKKDEAPEPKEADKGSAEEAKPKGERKSKIKALLAKLRSKKEGTKGAS
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVPGMSKPDGDSGAQAASPGLGGMGKSNIASMFTGKGSEGGGGGIGGGGKLDIKSLIAKLKAKGGEVTKRSTEPTGNLVWKREDASKAKPAESEQAPPPVSPPKEADSSKKSERKKKKAEAKKQASASKERRQELGGGKIDIKSIFSNLKAKASGASATPGASPPTAGITKRAEHSIRNIIWKRADAPDPKSAPKAPTKPGSPPKEPSPLEKKDEAPEPKEADKGSAEEAKPKGERKSKIKALLAKLRSKKEGTKGASAPPPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.11
4 0.09
5 0.09
6 0.07
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.08
13 0.08
14 0.09
15 0.09
16 0.1
17 0.11
18 0.11
19 0.12
20 0.11
21 0.12
22 0.11
23 0.12
24 0.11
25 0.11
26 0.09
27 0.07
28 0.07
29 0.06
30 0.05
31 0.05
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.08
42 0.1
43 0.15
44 0.19
45 0.22
46 0.23
47 0.29
48 0.29
49 0.29
50 0.31
51 0.33
52 0.37
53 0.37
54 0.4
55 0.37
56 0.37
57 0.38
58 0.36
59 0.32
60 0.25
61 0.26
62 0.26
63 0.3
64 0.3
65 0.31
66 0.3
67 0.29
68 0.29
69 0.29
70 0.3
71 0.28
72 0.32
73 0.37
74 0.37
75 0.37
76 0.36
77 0.34
78 0.35
79 0.32
80 0.3
81 0.26
82 0.3
83 0.29
84 0.28
85 0.28
86 0.29
87 0.28
88 0.25
89 0.26
90 0.22
91 0.28
92 0.29
93 0.33
94 0.31
95 0.37
96 0.43
97 0.47
98 0.52
99 0.57
100 0.66
101 0.71
102 0.76
103 0.79
104 0.82
105 0.86
106 0.89
107 0.9
108 0.87
109 0.84
110 0.79
111 0.74
112 0.67
113 0.65
114 0.62
115 0.58
116 0.56
117 0.51
118 0.46
119 0.42
120 0.44
121 0.38
122 0.38
123 0.32
124 0.26
125 0.25
126 0.25
127 0.25
128 0.2
129 0.17
130 0.1
131 0.1
132 0.1
133 0.11
134 0.16
135 0.16
136 0.18
137 0.17
138 0.17
139 0.16
140 0.16
141 0.15
142 0.1
143 0.11
144 0.09
145 0.09
146 0.1
147 0.09
148 0.09
149 0.08
150 0.08
151 0.06
152 0.09
153 0.11
154 0.11
155 0.14
156 0.16
157 0.18
158 0.2
159 0.24
160 0.22
161 0.22
162 0.27
163 0.32
164 0.31
165 0.39
166 0.4
167 0.39
168 0.4
169 0.39
170 0.37
171 0.33
172 0.37
173 0.33
174 0.35
175 0.4
176 0.41
177 0.43
178 0.43
179 0.42
180 0.4
181 0.44
182 0.45
183 0.43
184 0.46
185 0.47
186 0.53
187 0.6
188 0.63
189 0.6
190 0.6
191 0.59
192 0.62
193 0.6
194 0.59
195 0.58
196 0.57
197 0.56
198 0.55
199 0.52
200 0.47
201 0.55
202 0.53
203 0.47
204 0.47
205 0.46
206 0.44
207 0.44
208 0.4
209 0.33
210 0.29
211 0.28
212 0.25
213 0.28
214 0.26
215 0.3
216 0.31
217 0.34
218 0.37
219 0.4
220 0.45
221 0.47
222 0.55
223 0.55
224 0.65
225 0.68
226 0.72
227 0.75
228 0.74
229 0.75
230 0.76
231 0.76
232 0.75
233 0.74
234 0.72
235 0.71
236 0.67
237 0.66
238 0.65
239 0.67
240 0.63
241 0.64
242 0.6
243 0.62
244 0.63