Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VBL7

Protein Details
Accession A0A2N5VBL7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-42GPRQARTSAKKPKKSALKKIYQCPHCHydrophilic
NLS Segment(s)
PositionSequence
23-34TSAKKPKKSALK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPAQSHTPNALPNDNSGPRQARTSAKKPKKSALKKIYQCPHCTYVSDRADNVKSHVKTVNEEPDKGRCHHPECPRVYKRKADLTKHLRQDHGDDSPKDKRTVHPKKIPEDEIKILASLPPSAQIDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.37
4 0.37
5 0.33
6 0.35
7 0.36
8 0.37
9 0.42
10 0.51
11 0.57
12 0.63
13 0.7
14 0.72
15 0.77
16 0.79
17 0.81
18 0.82
19 0.81
20 0.81
21 0.79
22 0.84
23 0.84
24 0.79
25 0.74
26 0.68
27 0.62
28 0.53
29 0.47
30 0.41
31 0.41
32 0.4
33 0.37
34 0.32
35 0.32
36 0.33
37 0.32
38 0.31
39 0.3
40 0.25
41 0.26
42 0.29
43 0.25
44 0.25
45 0.29
46 0.35
47 0.29
48 0.3
49 0.29
50 0.31
51 0.33
52 0.33
53 0.34
54 0.29
55 0.31
56 0.38
57 0.45
58 0.48
59 0.51
60 0.59
61 0.61
62 0.65
63 0.65
64 0.64
65 0.62
66 0.64
67 0.66
68 0.61
69 0.65
70 0.65
71 0.69
72 0.71
73 0.68
74 0.6
75 0.54
76 0.52
77 0.46
78 0.45
79 0.43
80 0.36
81 0.39
82 0.45
83 0.47
84 0.45
85 0.42
86 0.42
87 0.47
88 0.56
89 0.6
90 0.62
91 0.66
92 0.72
93 0.78
94 0.78
95 0.73
96 0.69
97 0.63
98 0.57
99 0.5
100 0.42
101 0.34
102 0.29
103 0.23
104 0.17
105 0.13
106 0.15