Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W933

Protein Details
Accession A0A2N5W933    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-89CYSRRQSVRIHQPRRHQRSHDKPMDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MLALGSSQETTAVWNRQLSHPSDAEPSEEISRAPMQPAPRSESYSCLQLSSTQSLPLGQQQIPCYSRRQSVRIHQPRRHQRSHDKPMDEDDNRQAAPRSNASVVRLNAIENWRLKEMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.3
4 0.34
5 0.35
6 0.34
7 0.31
8 0.31
9 0.32
10 0.3
11 0.27
12 0.23
13 0.22
14 0.18
15 0.18
16 0.16
17 0.15
18 0.17
19 0.15
20 0.15
21 0.16
22 0.17
23 0.22
24 0.25
25 0.28
26 0.27
27 0.32
28 0.31
29 0.33
30 0.3
31 0.3
32 0.27
33 0.21
34 0.2
35 0.18
36 0.2
37 0.19
38 0.18
39 0.14
40 0.14
41 0.14
42 0.14
43 0.14
44 0.14
45 0.12
46 0.14
47 0.15
48 0.19
49 0.2
50 0.21
51 0.21
52 0.21
53 0.26
54 0.27
55 0.29
56 0.31
57 0.38
58 0.49
59 0.56
60 0.63
61 0.63
62 0.71
63 0.78
64 0.81
65 0.79
66 0.76
67 0.76
68 0.78
69 0.82
70 0.8
71 0.72
72 0.65
73 0.64
74 0.65
75 0.56
76 0.49
77 0.43
78 0.39
79 0.35
80 0.35
81 0.31
82 0.27
83 0.29
84 0.29
85 0.28
86 0.27
87 0.3
88 0.32
89 0.37
90 0.34
91 0.32
92 0.3
93 0.26
94 0.28
95 0.29
96 0.31
97 0.27
98 0.31