Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TNS3

Protein Details
Accession A0A2N5TNS3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
132-158AGKADPQQAKKPQKKARRSRRSGAAVAHydrophilic
NLS Segment(s)
PositionSequence
140-154AKKPQKKARRSRRSG
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, cyto 7.5, pero 7, mito 2
Family & Domain DBs
Amino Acid Sequences MHEVLNISHYADEPNPNSSDPKFLNSGNELDTEAQQEGPLVVPTVKTKNPVRGLKIQIRAKKPAVEMVDKAPAVPNNIGRKKPLKTKNGSDYLKPLTDEDWDRIEAWGAAFFAAHWKAQEGNDDLKLKSTFAGKADPQQAKKPQKKARRSRRSGAAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.28
5 0.26
6 0.31
7 0.26
8 0.28
9 0.27
10 0.26
11 0.3
12 0.29
13 0.3
14 0.24
15 0.23
16 0.21
17 0.19
18 0.19
19 0.17
20 0.14
21 0.12
22 0.11
23 0.1
24 0.09
25 0.08
26 0.08
27 0.07
28 0.06
29 0.07
30 0.1
31 0.15
32 0.16
33 0.21
34 0.24
35 0.32
36 0.4
37 0.44
38 0.47
39 0.5
40 0.56
41 0.58
42 0.63
43 0.62
44 0.6
45 0.59
46 0.6
47 0.54
48 0.51
49 0.44
50 0.4
51 0.37
52 0.32
53 0.29
54 0.26
55 0.28
56 0.24
57 0.23
58 0.2
59 0.17
60 0.16
61 0.16
62 0.19
63 0.24
64 0.28
65 0.29
66 0.3
67 0.34
68 0.36
69 0.44
70 0.47
71 0.47
72 0.49
73 0.56
74 0.61
75 0.66
76 0.64
77 0.55
78 0.52
79 0.46
80 0.41
81 0.34
82 0.26
83 0.18
84 0.2
85 0.2
86 0.18
87 0.17
88 0.16
89 0.16
90 0.16
91 0.15
92 0.12
93 0.11
94 0.09
95 0.07
96 0.06
97 0.06
98 0.06
99 0.09
100 0.1
101 0.1
102 0.09
103 0.1
104 0.12
105 0.13
106 0.18
107 0.17
108 0.2
109 0.25
110 0.27
111 0.26
112 0.29
113 0.29
114 0.25
115 0.23
116 0.22
117 0.19
118 0.19
119 0.25
120 0.22
121 0.29
122 0.38
123 0.44
124 0.44
125 0.5
126 0.59
127 0.64
128 0.71
129 0.74
130 0.75
131 0.78
132 0.86
133 0.88
134 0.9
135 0.9
136 0.9
137 0.89
138 0.89