Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5T989

Protein Details
Accession A0A2N5T989    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
88-109SSFSIYCKNKLRRFSNRSTHPNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 10.833, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSDSANSPTTTPSEPTGMVPGSIREQQGLIEQNFQNLANKVKPYAPMNAAHHVPVKTNHVPVETNHVPLELWIPIEKRGTKPSIDYDSSFSIYCKNKLRRFSNRSTHPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.23
4 0.2
5 0.18
6 0.17
7 0.16
8 0.17
9 0.2
10 0.19
11 0.15
12 0.15
13 0.15
14 0.19
15 0.22
16 0.19
17 0.22
18 0.22
19 0.22
20 0.23
21 0.23
22 0.21
23 0.18
24 0.2
25 0.17
26 0.18
27 0.18
28 0.19
29 0.22
30 0.21
31 0.23
32 0.23
33 0.25
34 0.27
35 0.29
36 0.28
37 0.26
38 0.27
39 0.23
40 0.22
41 0.18
42 0.21
43 0.2
44 0.21
45 0.2
46 0.19
47 0.19
48 0.19
49 0.26
50 0.21
51 0.21
52 0.19
53 0.19
54 0.17
55 0.16
56 0.18
57 0.09
58 0.09
59 0.09
60 0.1
61 0.11
62 0.16
63 0.18
64 0.19
65 0.24
66 0.26
67 0.26
68 0.28
69 0.33
70 0.35
71 0.36
72 0.35
73 0.33
74 0.34
75 0.34
76 0.31
77 0.25
78 0.26
79 0.27
80 0.31
81 0.37
82 0.44
83 0.49
84 0.58
85 0.67
86 0.72
87 0.76
88 0.81
89 0.82