Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NN93

Protein Details
Accession J3NN93   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-45ELPVSARRRKKWAWKWKERRKKRKGNNKRSQSTLHBasic
NLS Segment(s)
PositionSequence
16-39ARRRKKWAWKWKERRKKRKGNNKR
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MEGGYGVVSAELPVSARRRKKWAWKWKERRKKRKGNNKRSQSTLHAAASMRPAPDWSRWTACSASKWQPTAKRFHSNPPNWDGRRVIKSFCAAAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.24
3 0.31
4 0.35
5 0.43
6 0.51
7 0.61
8 0.68
9 0.73
10 0.77
11 0.81
12 0.88
13 0.92
14 0.95
15 0.95
16 0.96
17 0.95
18 0.95
19 0.94
20 0.95
21 0.95
22 0.95
23 0.94
24 0.94
25 0.87
26 0.8
27 0.74
28 0.67
29 0.6
30 0.53
31 0.42
32 0.33
33 0.29
34 0.25
35 0.24
36 0.2
37 0.15
38 0.11
39 0.12
40 0.12
41 0.15
42 0.17
43 0.18
44 0.2
45 0.21
46 0.23
47 0.24
48 0.25
49 0.25
50 0.29
51 0.33
52 0.34
53 0.36
54 0.39
55 0.45
56 0.47
57 0.52
58 0.53
59 0.55
60 0.53
61 0.61
62 0.66
63 0.65
64 0.67
65 0.65
66 0.69
67 0.61
68 0.63
69 0.58
70 0.55
71 0.56
72 0.52
73 0.48
74 0.43
75 0.45