Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VH59

Protein Details
Accession A0A2N5VH59   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-26SKTVENIERKKQKPNYQNKKETSWGHydrophilic
NLS Segment(s)
PositionSequence
31-48RPKGVRTPSQTPKKRRAG
Subcellular Location(s) mito 11, nucl 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MSKTVENIERKKQKPNYQNKKETSWGLIAARPKGVRTPSQTPKKRRAGAAHLPNQACKPPHAARHPHAYKWREDGRLGMRPRWTGVLAMHACPEGVQALHNLRTGVHGRHACPTRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.82
4 0.82
5 0.9
6 0.84
7 0.81
8 0.75
9 0.68
10 0.6
11 0.51
12 0.44
13 0.35
14 0.33
15 0.31
16 0.28
17 0.28
18 0.25
19 0.23
20 0.24
21 0.26
22 0.28
23 0.31
24 0.39
25 0.45
26 0.55
27 0.63
28 0.66
29 0.73
30 0.77
31 0.74
32 0.7
33 0.67
34 0.65
35 0.66
36 0.68
37 0.65
38 0.62
39 0.58
40 0.53
41 0.48
42 0.42
43 0.33
44 0.24
45 0.24
46 0.21
47 0.28
48 0.33
49 0.38
50 0.38
51 0.48
52 0.5
53 0.49
54 0.53
55 0.49
56 0.45
57 0.46
58 0.49
59 0.41
60 0.39
61 0.39
62 0.36
63 0.42
64 0.42
65 0.39
66 0.36
67 0.35
68 0.35
69 0.33
70 0.27
71 0.21
72 0.19
73 0.24
74 0.22
75 0.22
76 0.21
77 0.19
78 0.18
79 0.16
80 0.16
81 0.08
82 0.07
83 0.07
84 0.1
85 0.14
86 0.16
87 0.18
88 0.17
89 0.17
90 0.21
91 0.25
92 0.23
93 0.28
94 0.3
95 0.31
96 0.4
97 0.44