Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5TLE7

Protein Details
Accession A0A2N5TLE7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-105PPELRNLKPPPKRKQPAHRSARIRINIPKAPKAVKEKDPPKKKVPVVHydrophilic
NLS Segment(s)
PositionSequence
61-101ELRNLKPPPKRKQPAHRSARIRINIPKAPKAVKEKDPPKKK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSDLSESSSEEDQLADEPELVANQPTIEAAKSNLINPNAWTPISTGPPRPVPPENRVPPELRNLKPPPKRKQPAHRSARIRINIPKAPKAVKEKDPPKKKVPVVFSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.1
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.07
17 0.07
18 0.11
19 0.12
20 0.14
21 0.18
22 0.19
23 0.19
24 0.2
25 0.22
26 0.19
27 0.19
28 0.17
29 0.14
30 0.15
31 0.19
32 0.19
33 0.18
34 0.2
35 0.23
36 0.24
37 0.27
38 0.29
39 0.29
40 0.33
41 0.4
42 0.42
43 0.42
44 0.43
45 0.41
46 0.37
47 0.42
48 0.44
49 0.36
50 0.4
51 0.42
52 0.49
53 0.56
54 0.63
55 0.64
56 0.68
57 0.76
58 0.77
59 0.82
60 0.84
61 0.86
62 0.86
63 0.86
64 0.82
65 0.8
66 0.8
67 0.73
68 0.68
69 0.64
70 0.63
71 0.59
72 0.57
73 0.55
74 0.5
75 0.5
76 0.51
77 0.53
78 0.53
79 0.56
80 0.62
81 0.67
82 0.73
83 0.8
84 0.8
85 0.79
86 0.81
87 0.79
88 0.77
89 0.74