Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PJ39

Protein Details
Accession J3PJ39    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-36RTSTPSTYDRRNRHHRYSWVQHydrophilic
NLS Segment(s)
PositionSequence
159-172GRRKAHPPPRRTKG
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MRPHTRSTPRPGLTSRTSTPSTYDRRNRHHRYSWVQAQSGRQTQSIILALPGRALFKSDPDLTARKSLPRRVADYGGAGHYFPVVLTTMNSLVGDEASRLLWISLRQGASADQCVYAPVKYHSFCSGAAGQKSSKAHSLVALTRTATSLPSYLGKQMTGRRKAHPPPRRTKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.52
3 0.48
4 0.47
5 0.42
6 0.43
7 0.44
8 0.45
9 0.48
10 0.54
11 0.57
12 0.64
13 0.74
14 0.79
15 0.8
16 0.81
17 0.8
18 0.79
19 0.8
20 0.79
21 0.74
22 0.69
23 0.62
24 0.59
25 0.57
26 0.54
27 0.46
28 0.37
29 0.32
30 0.29
31 0.28
32 0.24
33 0.17
34 0.12
35 0.12
36 0.11
37 0.11
38 0.12
39 0.1
40 0.09
41 0.11
42 0.1
43 0.1
44 0.15
45 0.15
46 0.16
47 0.18
48 0.21
49 0.21
50 0.26
51 0.25
52 0.27
53 0.31
54 0.36
55 0.4
56 0.41
57 0.44
58 0.42
59 0.43
60 0.37
61 0.34
62 0.29
63 0.22
64 0.19
65 0.14
66 0.1
67 0.08
68 0.07
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.07
91 0.11
92 0.11
93 0.11
94 0.11
95 0.13
96 0.13
97 0.15
98 0.13
99 0.1
100 0.1
101 0.11
102 0.11
103 0.1
104 0.1
105 0.11
106 0.15
107 0.15
108 0.17
109 0.19
110 0.2
111 0.2
112 0.22
113 0.24
114 0.25
115 0.26
116 0.26
117 0.24
118 0.27
119 0.29
120 0.27
121 0.26
122 0.22
123 0.21
124 0.22
125 0.26
126 0.25
127 0.26
128 0.25
129 0.22
130 0.21
131 0.21
132 0.19
133 0.16
134 0.13
135 0.11
136 0.12
137 0.14
138 0.15
139 0.18
140 0.19
141 0.2
142 0.23
143 0.31
144 0.39
145 0.46
146 0.48
147 0.5
148 0.59
149 0.68
150 0.74
151 0.75
152 0.76